IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ olsen-2004-2 Insights into the molecular basis for fibroblast growth factor receptor autoinhibition and ligand-binding promiscuity. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Olsen SK., Ibrahimi OA., Raucci A., Zhang F., Eliseenkova AV., Yayon A., Basilico C., Linhardt RJ., Schlessinger J., Mohammadi M. Apoptosis - Interactions involving proteins with a function related to apoptosis Table 1 and Fig. 1 mohammad@saturn.med.nyu.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 olsen-2004-1 Insights into the molecular basis for fibroblast growth factor receptor autoinhibition and ligand-binding promiscuity. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Olsen SK., Ibrahimi OA., Raucci A., Zhang F., Eliseenkova AV., Yayon A., Basilico C., Linhardt RJ., Schlessinger J., Mohammadi M. Apoptosis - Interactions involving proteins with a function related to apoptosis Table 1 and Fig. 1 mohammad@saturn.med.nyu.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 fgfr3_human Fibroblast growth factor receptor 3 FGFR3 JTK4 protein protein human Homo sapiens Human MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT fgf1_human Fibroblast growth factor 1 Acidic fibroblast growth factor FGF1 FGFA Heparin-binding growth factor 1 Endothelial cell growth factor protein protein human Homo sapiens Human MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD fgf-fgfr-2 Interaction between FGF and FGFR3 determined by surface plasmon resonance 219615 N/A 219617 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) N/A 219618 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Kd given in text = 916nM, Kd given in Table 1 = 91,600nM however comparison with rest of table suggests the latter is a misprint. fgf-fgfr-3 Interaction between FGF and FGFR3 determined by surface plasmon resonance 219615 N/A 219617 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) N/A 219618 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false fgf-fgfr-4 Interaction between FGFR3 immunoglobulin domains determined by surface plasmon resonance 219615 N/A 219617 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) N/A 219617 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false fgf-fgfr-1 Interaction between FGF and FGFR3 determined by X-ray crystallography 219616 N/A 219617 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false lys319glu320glu322 required to bind necessary binding region required to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false glu320 required to bind necessary binding region required to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 219618 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tyr23-lys24 binding region binding-associated region binding region x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false tyr23-lys24 required to bind necessary binding region required to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false gly21 required to bind necessary binding region required to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 219638 219634 219640 219635 219641 219636 direct interaction direct interaction false false false working 27.7%, free 34.1% 3.20A