IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ potuschak-2003-1 EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Potuschak T., Lechner E., Parmentier Y., Yanagisawa S., Grava S., Koncz C., Genschik P. A cDNA library derived from 3 week old green vegitative tissue of arabidopsis was used in this study. Cell (0092-8674) 2003 potuschak-2003-3 EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Potuschak T., Lechner E., Parmentier Y., Yanagisawa S., Grava S., Koncz C., Genschik P. Total protein extract prepared from an arabidopsis cell suspension culture. A cDNA library derived from 3 week old green vegitative tissue of arabidopsis was used in this study. Cell (0092-8674) 2003 potuschak-2003-2 EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Potuschak T., Lechner E., Parmentier Y., Yanagisawa S., Grava S., Koncz C., Genschik P. A cDNA library derived from 3 week old green vegitative tissue of arabidopsis was used in this study. Cell (0092-8674) 2003 skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE ebf1_arath EIN3-binding F-box protein 1 EBF1 At2g25490 F-box/LRR-repeat protein 6 FBL6 F13B15.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQKEIDVPSKITEDGDDCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSIRGSNSAKVSDLGLRSIGRSCPSLGSLSLWNVSTITDNGLLEIAEGCAQLEKLELNRCSTITDKGLVAIAKSCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTITACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQSSLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALASSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS skp1b_arath SKP1-like protein 1B SKP1-like 2 UFO-binding protein 2 ASK2 UIP2 At5g42190 MJC20.30 SKP1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE ein3_arath Protein ETHYLENE INSENSITIVE 3 EIN3 At3g20770 MOE17.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMFNEMGMCGNMDFFSSGSLGEVDFCPVPQAEPDSIVEDDYTDDEIDVDELERRMWRDKMRLKRLKEQDKGKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPAAITKYQAENNIPGIHEGNNPIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWWPQLGLPKDQGPAPYKKPHDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLARELYPESCPPLSLSGGSCSLLMNDCSQYDVEGFEKESHYEVEELKPEKVMNSSNFGMVAKMHDFPVKEEVPAGNSEFMRKRKPNRDLNTIMDRTVFTCENLGCAHSEISRGFLDRNSRDNHQLACPHRDSRLPYGAAPSRFHVNEVKPVVGFPQPRPVNSVAQPIDLTGIVPEDGQKMISELMSMYDRNVQSNQTSMVMENQSVSLLQPTVHNHQEHLQFPGNMVEGSFFEDLNIPNRANNNNSSNNQTFFQGNNNNNNVFKFDTADHNNFEAAHNNNNNSSGNRFQLVFDSTPFDMASFDYRDDMSMPGVVGTMDGMQQKQQDVSIWF eil1_arath ETHYLENE INSENSITIVE 3-like 1 protein EIL1 At2g27050 T20P8.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMMFNEMGMYGNMDFFSSSTSLDVCPLPQAEQEPVVEDVDYTDDEMDVDELEKRMWRDKMRLKRLKEQQSKCKEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQSENNISGGSNDCNSLVGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGNEEWWPQLGLPNEQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEVVARELYPESCPPLSSSSSLGSGSLLINDCSEYDVEGFEKEQHGFDVEERKPEIVMMHPLASFGVAKMQHFPIKEEVATTVNLEFTRKRKQNNDMNVMVMDRSAGYTCENGQCPHSKMNLGFQDRSSRDNHQMVCPYRDNRLAYGASKFHMGGMKLVVPQQPVQPIDLSGVGVPENGQKMITELMAMYDRNVQSNQTPPTLMENQSMVIDAKAAQNQQLNFNSGNQMFMQQGTNNGVNNRFQMVFDSTPFDMAAFDYRDDWQTGAMEGMGKQQQQQQQQQDVSIWF ebf2_arath EIN3-binding F-box protein 2 EBF2 F18G18.90 At5g25350 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGIFRFSGDEDCLLGGSMYLSPGSCPGVYYPARKRLRVAATSFYSGFEEKQTSIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEVNESSVQDVEEGEGFLSRSLEGKKATDLRLAAIAVGTSSRGGLGKLQIRGSGFESKVTDVGLGAVAHGCPSLRIVSLWNLPAVSDLGLSEIARSCPMIEKLDLSRCPGITDSGLVAIAENCVNLSDLTIDSCSGVGNEGLRAIARRCVNLRSISIRSCPRIGDQGVAFLLAQAGSYLTKVKLQMLNVSGLSLAVIGHYGAAVTDLVLHGLQGVNEKGFWVMGNAKGLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLMGFLMNCGSKLKAFSLANCLGISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLAFLGKFCHQLQDVELCGLNGVTDAGVRELLQSNNVGLVKVNLSECINVSDNTVSAISVCHGRTLESLNLDGCKNITNASLVAVAKNCYSVNDLDISNTLVSDHGIKALASSPNHLNLQVLSIGGCSSITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTLLENLWRCDILY srk2a_arath Serine/threonine-protein kinase SRK2A SRK2A At1g10940 T19D16.14 ASK1 OSKL7 SNRK2.4 Arabidopsis protein SK1 OST1-kinase-like 7 SNF1-related kinase 2.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNIIRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYIAPEVLSRREYDGKMADVWSCGVTLYVMLVGAYPFEDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKNLLSRIFVANSLKRITIAEIKKHSWFLKNLPRELTETAQAAYFKKENPTFSLQTVEEIMKIVADAKTPPPVSRSIGGFGWGGNGDADGKEEDAEDVEEEEEEVEEEEDDEDEYDKTVKEVHASGEVRIS cul1_arath Cullin-1 CUL1 At4g02570 T10P11.26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKTIDLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPHDYSQQLYDKYREAFEEYINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYFIARRSLPPLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQHELLVVFASQLLEKEHSGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECFQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPGIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKILLKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPLPPVDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYLA ebf1-ask1 Yeast 2 hybrid analysis reveals interction between the F-box protein AtFBL6 and ASK1 protein 184598 N/A 184601 unspecified role unspecified role prey prey N/A 184602 unspecified role unspecified role bait bait physical association physical association false false false ebf1-ask2 Yeast 2 hybrid analysis reveals interction between the F-box protein AtFBL6 and ASK2 protein 184598 N/A 184603 unspecified role unspecified role prey prey N/A 184602 unspecified role unspecified role bait bait physical association physical association false false false ebf1-ein3 Yeast 2 hybrid analysis reveals interction between the F-box protein AtFBL6 and ETHYLENE-INSENSITIVE3 protein 184598 N/A 184602 unspecified role unspecified role bait bait N/A 184604 unspecified role unspecified role prey prey physical association physical association false false false ebf1-ein1 Yeast 2 hybrid analysis reveals interction between the F-box protein AtFBL6 and ETHYLENE-INSENSITIVE3-like 1 protein 184598 N/A 184602 unspecified role unspecified role bait bait N/A 184605 unspecified role unspecified role prey prey physical association physical association false false false ebf2-ask1 Yeast 2 hybrid analysis reveals interction between the EIN3-binding F-box protein 2 and ASK1 protein 184598 N/A 184601 unspecified role unspecified role prey prey N/A 184606 unspecified role unspecified role bait bait physical association physical association false false false ebf2-ask2 Yeast 2 hybrid analysis reveals interction between the EIN3-binding F-box protein 2 and ASK2 protein 184598 N/A 184603 unspecified role unspecified role prey prey N/A 184606 unspecified role unspecified role bait bait physical association physical association false false false ebf2-ein3 Yeast 2 hybrid analysis reveals interction between the EIN3-binding F-box protein 2 and ETHYLENE-INSENSITIVE3 protein 184598 N/A 184604 unspecified role unspecified role prey prey N/A 184606 unspecified role unspecified role bait bait physical association physical association false false false ebf2-ein1 Yeast 2 hybrid analysis reveals interction between the EIN3-binding F-box protein 2 and ETHYLENE-INSENSITIVE3-like 1 protein 184598 N/A 184606 unspecified role unspecified role bait bait N/A 184605 unspecified role unspecified role prey prey physical association physical association false false false ebf1-ask1-1 Yeast 2 hybrid analysis reveals interction between the F-box protein AtFBL6 and Serine/threonine-protein kinase ASK1 184599 N/A 184602 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 184607 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false ebf2-ask1-1 Yeast 2 hybrid analysis reveals interction between the EIN3-binding F-box protein 2 and Serine/threonine-protein kinase ASK1 184599 N/A 184607 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 184606 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false ebf2-cul1 Yeast 2 hybrid analysis reveals interction between the EIN3-binding F-box protein 2 and the Cullin1 protein 184599 N/A 184606 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 184608 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false ebf1-ask1-2 Yeast 2 hybrid analysis reveals interction between the F-box protein AtFBL6 and Cullin1 protein 184599 N/A 184608 unspecified role unspecified role prey prey N/A 184602 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false ebf1-ein3-1 Yeast 2 hybrid analysis reveals interction between the F-box protein AtFBL6 and ETHYLENE-INSENSITIVE3 protein 184600 N/A 184604 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184602 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false ebf2-ein3-1 Yeast 2 hybrid analysis reveals interction between the EIN3-binding F-box protein 2 and ETHYLENE-INSENSITIVE3 protein 184600 N/A 184606 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184604 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false