IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ biteau-2003-1 ATP-dependent reduction of cysteine-sulphinic acid by S. cerevisiae sulphiredoxin. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast biochemical biochemical western blot western blot Immuno blot Immuno blot Biteau B., Labarre J., Toledano MB. Nature (0028-0836) 2003 tsa1_yeast Peroxiredoxin TSA1 TSA1 TPX1 TSA YML028W Cytoplasmic thiol peroxidase 1 Thiol-specific antioxidant protein 1 ZRG14 Protector protein Thioredoxin peroxidase type Ia Thioredoxin-dependent peroxide reductase Thioredoxin-dependent peroxiredoxin TSA1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK 9ACF40E410F2C04A srx1_yeast Sulfiredoxin YKL086W SRX1 Sulphiredoxin protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLQSNSVKPTEIPLSEIRRPLAPVLDPQKIDAMVATMKGIPTASKTCSLEQAEAAASAGELPPVDVLGVRVKGQTLYYAFGGCHRLQAYDRRARETQNAAFPVRCRVLPATPRQIRMYLGSSLDIE srx1-tsa1-1 Interaction detected by copurification 174365 N/A 174366 unspecified role unspecified role neutral component neutral component N/A 174367 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Srx1 forms a transient disulphide bond with Tsa1 during reduction of Tsa1 cysteine-sulphinic acid.