IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xu-2003-1 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Nature (0028-0836) 2003 xu-2003-2 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Nature (0028-0836) 2003 xu-2003-4 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Directed yeast two hybrid assay used in this study. Nature (0028-0836) 2003 xu-2003-3 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Nature (0028-0836) 2003 xu-2003-5 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Nature (0028-0836) 2003 cul3_caeel Cullin-3 cul-3 Y108G3AL.1 protein protein caeel Caenorhabditis elegans MSGRSGNGGQQKMRIRPFMATIDEQYVTQTWELLKRAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGERLYNGLKDVIQDHMASVRIRIIESMNSGSFLETVAESWADHTVAMVMIRDILMYMDRIYVAQNNHVLPVYNLGLDAYRTEILRQNGIGDRIRDALLELIKLDRKSNQINWHGIKNACDMLISLGIDSRTVYEDEFERPLLKETSDYYRDVCKNWLSGDNDACFYLAQVEIAMHDEASRASRYLDKMTEAKILQVMDDVMVAEHIQTIVYMQNGGVKFMLEHKKIEDLTRIFRIFKRIGDSVTVPGGGLKALLKAVSEYLNETGSNIVKNEDLLKNPVNFVNELLQLKDYFSSLLTTAFADDRDFKNRFQHDFETFLNSNRQSPEFVALYMDDMLRSGLKCVSDAEMDNKLDNVMILFRYLQEKDVFEKYFKQYLAKRLLLDKSCSDDVEKALLAKLKTECGCQFTQKLENMFRDKELWLTLATSFRDWREAQPTKMSIDISLRVLTAGVWPTVQCNPVVLPQELSVAYEMFTQYYTEKHTGRKLTINTLLGNADVKATFYPPPKASMSNEENGPGPSSSGESMKERKPEHKILQVNTHQMIILLQFNHHNRISCQQLMDELKIPERELKRNLQSLALGKASQRILVRKNKGKDAIDMSDEFAVNDNFQSKLTRVKVQMVTGKVESEPEIRETRQKVEDDRKLEVEAAIVRIMKARKKLNHNNLVAEVTQQLRHRFMPSPIIIKQRIETLIEREYLARDEHDHRAYQYIA o16612_caeel B0281.5 CELE_B0281.5 protein protein caeel Caenorhabditis elegans MSGNTVKLNVGGTVFETLKSTLTKHDGFFKALIETDVPAEKDDSNCFFIDRSPKHFETVLNYMRSGDVVLPDSKKDMLELKKEAEYYLLSNLAKLCQPPTDNFKTCTPEELMRVVANTDKKVIMINYLTYNGELVFYPWGFNLVHFLIQNRDYVEDVYFRRTESQYPEDGPFPNEKPYWTFLVYNSTRSGRRPFRHTVDLEDCMGHM p91563_caeel ZC239.15 CELE_ZC239.15 protein protein caeel Caenorhabditis elegans MSETVKLDVGGTIFKTSRSTLTKFNGFFKTMLESDIGLKIDESGSIFIDRSPKNFDLILNFMRDGDVVLPNCELKLKELLVEAQFYLLDGLIELCNSKIELVEAPKIKLRFIESDEQFLQILAVQQKPMLIIEFCMVGNDMSIPYNFNLYEFMEKYSHQFDIYFQRLSEDEPSRKWKARIKWKPTENGYYSQFPHNLRINRGGRIIRDATFLERLEKMIGEFDEYLKKQRNR q18986_caeel D2045.8 CELE_D2045.8 protein protein caeel Caenorhabditis elegans MEPSTIVKLDVGGKIFKTTIFTLCKHDSMLKTMFCTDVPVTKNEEGSVFIDRDSKHFRLILNFLRDGQIALPDSDREVREVLAEASYFLLDPLIELCGERLEQSLNPYYHLVSTVLEARKIIFATEKPIVVLRLPVYIATSGNQSYYFSETKFRELSEEYHKHVAFILITEPEFNEDCSWSFFLRAKKITARIKGPMDCNLVEECMQKLLKDAEKRRRGTKSFFNEIPMELVEHEELH q965m5_caeel CELE_C17F4.8 C17F4.8 protein protein caeel Caenorhabditis elegans MCSKDNIVKLNVGGTVFQTSKSTLTMIDGFFKMMLESDIPLQKDDSNCIFIDRSPKHFDIILNFLRDGDVDLPEQEKEINEVKREAQFYLLEELVDLCHRKINTKIRVLISGTEKIEFYTKNDKPRLLIKYPEKNLDESPILDIDWGSLMEKYRDQFHIAFAPQNNCSLSANCQFKSVKSSIFLSIGDVSNDCEQFIDNFLKKHCGF q18776_caeel inso-1 C52B11.2 CELE_C52B11.2 protein protein caeel Caenorhabditis elegans MDTRKVSVSNTTSPRQSSDTEMSSSCATSTASAIDESDVRFSFQDTIQAIRHMSSNTDDSTNQNGVAAVKTNGFHYGSSSSSWVRLNVGGKVFQTTRSTLMREPCSFLYRLCQDEMGLPTDRDETGAYLIDRDPDFFSPILNYLRHGKLIMNPGLSEEGILAEADFYNLPSLSQLIMDRIQDRENSVKDATNKFVYRVLQCHEEELASVVSAMTDGWKIVQVVPINSNYTNYTTEQPQEYLCIVERECPDNGSMLEGQDRAKLLQQRARHN q94418_caeel CELE_ZK858.2 ZK858.2 protein protein caeel Caenorhabditis elegans MSSPSSASESDSSQMSLLATPPVAIRRPLPYPRDIISSPLEVATPVTVSPTDFMPIRELVTTPYHISTPVLITPVDARSISREIVRVNRIRRVRTRQASRSVFNSVRRRLSMITANRTEIQMNTPQTLPRSKRIDNTSTAMEPVSSNAFQKIISEILNNSPACTETINSTIIPSNSSNCAKLREFNRLESIGIAQMAVENENEILEALDFIEWNIRLMSCESDYIDKVLEDLENEKLNKQNKWERIELILSLIQD bat42_caeel BTB and MATH domain-containing protein 42 C50C3.8 bath-42 protein protein caeel Caenorhabditis elegans MSSRSSWSSTEQINRTISSRADDLPPQPRRLEVVSKQATRVTALSTKLEWKIEQFEKLMKLIKNGSNLISRMFSVPDAPTVCWELHVYPNGKRDEDVNNVSFFLRQVGLARGEEPIMTEFQIYALDANNQRVSVCRDTKDFTNQQGRGKFQVSRDKMLGALRSDGTLFLICEVEYFPPGSKISVEPVVDEDVSTEEQEEMPEVIVRANNRSMWEDELFTDCVIHVGNKHIKAHRCILGQNSPVFKSMFSSPNMIEAQKGEIHIEDAKYDSVRAMVEFMYTGATESLESQGNIDEILAIADKYEVLMLKDQCERLIAQTINLKNVTQIAMFSDTYTADYLKSAVIRFLTTHHRVVIKTQDWISLKKSRHELANELLEAVLSTDQDDDDVTSNIPISVSPPPARKRLRRSAK bat40_caeel BTB and MATH domain-containing protein 40 Y105E8B.4 bath-40 protein protein caeel Caenorhabditis elegans MSDRHLYGSDHSYLSSKPSCSSCRRQSSTSQKNECMTNPGSIVLTQRWTVCNFESLLKLSRPGSCLRSTVFKDDAVPDACWQLCLYPGGKREENANNVSLFLKMSATSPSKEVVLKAEYRFYFLDDNDEPKFSNVNVGEFHAKPPKGGHSWGLRNIPTQKVQNSIRQDKSLVISCHIELIPDASKVPCKRVPITPSIEMPFAQIPRAHVESELEMLASGDGTDMTIVAGPLDGEREQFRVHAYKLRAHSDVFQMMLSHTEMRENQEKRIEILDFSPTSVRAMVEFIYAGVIKSDIDVYQAVDVMQIAEKYQILALKMTCEQHLLDRLNVNNVLECITHAERYNTDVLYDACVDFAIHNRQHVMALTSWRNFISDEPVLASNLLEKMVKSNDNSSPPVKKPRV bat15_caeel BTB and MATH domain-containing protein 15 C08C3.2 bath-15 protein protein caeel Caenorhabditis elegans MVAASKEFVFHHTFKDVSQLEDGDFFKSPEEIHYNAEWFILVIRTKDQLEAYLHCDNEKDDNVAWTVDAEFSLKIASSSGSYAMKFQKGCFDGFGLGWNDFVSWDSLTEDFLYDNSFTIEACVKITKMTGFSKDVLRSFDESEKRFSDVILVVGDEKFYVLKLFLASHSSYFNALFLGKFKEADQSEVTLQNIDPTDFQSLLEVLYGEPAIDDGTIDGVLLLAHMLDVTLAIRKCEEFLIEKSMKSMRELLKMANQYQLENLKTVCISKINTI o45593_caeel btb-20 CELE_F57C2.1 F57C2.1 protein protein caeel Caenorhabditis elegans MADEVIEYKFTCSSFYYGRETSQVLNTSITKGLKCVWKTRYASIAEQAFFSWEFDWNELKRLGIDSLAGNITVKSASMSPLNVQIDLRKPTEIVERAFYLRDDDYAYNSYINKTTFEYSFVPYCAQVDESLYEKMFLPSDENDAILVIGNKKLHVCKAFLSYHSSFFRAIFSSAFKEGQMSEIPIKDVTYKDFALMLSTIYPDAVFPNDRTVEKLLEMGDRFIIQSVINHVEYHLLHNTSIGNEKLMWMADRYGMPKLLVKSIQQMNSIEKAKALKSSPDYAKLSKEAKEKILDRLMALI bat41_caeel BTB and MATH domain-containing protein 41 F37A4.9 bath-41 protein protein caeel Caenorhabditis elegans MEINNGAQPENAAVSIPSRSPSGKSEKRKSPSIVSGCRTVMNERSFTNYWSVERFTVQLELHNPAEFMLAPKFGDGDYEFVMKLFPNGKDEETAGYLSLFLLINKCPNPRLRFRVSFTVETADGPRSCHLNKNLVTINRSGIVTASKFFSLDILRSAMNVYIPNDILTIGCELTIFGECTTQISSLFKPYQRTHSASSTSRSLSSPNTKCLKIDESSAHDAFTEFLSTGEFSDFIIVASCGREFPTHMCILAARSEYFKVLLRNHSTKEFMSKRLQFDDISARTLDVLLRHMYASAAGRVVKLEEDQLTEDLISAMDRLMINSLRDEVARLIGSKVTVDNVLTRISMAAELRLDDTYDVLLDFFSNHKHECMKLTAWDELESAKPPLAIKILRDAFSNTDSPSTTSMDSRIIDRITLT mel26_caeel Protein maternal effect lethal 26 ZK858.4 mel-26 protein protein caeel Caenorhabditis elegans MEPRIDGGVFIGGIGNSGNEMCSNGVPALGVSSQTEIKVEKVQHTWTVKNFSHCYQEYLENFVYLQRGDEQLTWSIKIYPKGNGENNKDFVFLCLNRVINNNVKAGKIGFKSQFKLRTAENKDIEMRIHPNPSHSDYVSYIKRDVLFPQIMPRDMIIVNVEIDVAVETITTTNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATALLIAADKYRLEELKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILKGHPNLITDIFSQIDRQSSTGATSSVSNLPGVPMDIPGITGNIVPPPSGL p34808-2 Meiotic spindle formation protein mei-1 mei-1 Katanin p60 ATPase-containing subunit A1 p60 katanin T01G9.5 protein protein caeel Caenorhabditis elegans MNGDVQSVIRGYLERAQVAKTMSDAGRWNEAGDLLRQLMTDVKSCKISASNRDEHDARNTFLRALEANLKLVQQNVRDEDDLHEAMTRQSGSPEPPADPDVWSKPSPPLPSSSKFGATKKGVGAAGPRPREISKSTSSMSTNPADVKPANPTQGILPQNSAGDSFDASAYDAYIVQAVRGTMATNTENTMSLDDIIGMHDVKQVLHEAVTLPLLVPEFFQGLRSPWKAMVLAGPPGTGKTLIARAIASESSSTFFTVSSTDLSSKWRGDSEKIVRLLFELARFYAPSIIFIDEIDTLGGQRGNSGEHEASRRVKSEFLVQMDGSQNKFDSRRVFVLAATNIPWELDEALRRRFEKRIFIPLPDIDARKKLIEKSMEGTPKSDEINYDDLAARTEGFSGADVVSLCRTAAINVLRRYFRYDTKSLRGGELTAAMESLKAELVRNIDFEAALQAVSPSAGPDTMLKCKEWCDSFGAM No experimental confirmation available. nedd8_caeel NEDD8 Ubiquitin-like protein Nedd8 Neddylin Protein NED-8 ned-8 F45H11.2 protein protein caeel Caenorhabditis elegans MLIKVKTLTGKEIELDIEPNDRVERIKEKVEEKEGIPPPQQRLIFAGKQMNDDKTAADYKVLGGSVLHLVLALRGGF cul3-016612 Yeast two hybrid analysis reveals interaction between Cullin3 and hypothetical protein B0281.5 184280 N/A 184285 unspecified role unspecified role bait bait N/A 184286 unspecified role unspecified role prey prey physical association physical association false false false cul3-p91563 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein ZC239.15 184280 N/A 184285 unspecified role unspecified role bait bait N/A 184287 unspecified role unspecified role prey prey physical association physical association false false false cul3-q18986 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein D2045.8 184280 N/A 184285 unspecified role unspecified role bait bait N/A 184288 unspecified role unspecified role prey prey physical association physical association false false false cul3-q965m5 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein C17F4.8 184280 N/A 184285 unspecified role unspecified role bait bait N/A 184289 unspecified role unspecified role prey prey physical association physical association false false false cul3-q18776 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein C52B11.2 184280 N/A 184285 unspecified role unspecified role bait bait N/A 184290 unspecified role unspecified role prey prey physical association physical association false false false cul3-q94418 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein ZK858.2 184280 N/A 184291 unspecified role unspecified role prey prey N/A 184285 unspecified role unspecified role bait bait physical association physical association false false false cul3-p34371 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein C50C3.8 184280 N/A 184292 unspecified role unspecified role prey prey N/A 184285 unspecified role unspecified role bait bait physical association physical association false false false cul3-q9nf14 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein Y105E8B.4 184280 N/A 184285 unspecified role unspecified role bait bait N/A 184293 unspecified role unspecified role prey prey physical association physical association false false false cul3-p34324 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein C08C3.2 184280 N/A 184294 unspecified role unspecified role prey prey N/A 184285 unspecified role unspecified role bait bait physical association physical association false false false cul3-o45593 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein F57C2.1 184280 N/A 184285 unspecified role unspecified role bait bait N/A 184295 unspecified role unspecified role prey prey physical association physical association false false false cul3-p41886 Yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein F37A4.9 184280 N/A 184296 unspecified role unspecified role prey prey N/A 184285 unspecified role unspecified role bait bait physical association physical association false false false cul3-p41886-1 GST pulldown analysis reveals interaction between Cullin3 and hypothetical protein F37A4.9 184281 N/A 184296 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184285 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cul3-16613-1 GST pulldown analysis reveals interaction between Cullin3 and hypothetical protein B0281.5 184281 N/A 184285 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184286 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cul3-q18986-1 GST pulldown analysis reveals interaction between Cullin3 and hypothetical protein D2045.8 184281 N/A 184285 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184288 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cul3-q18776-1 GST pulldown analysis reveals interaction between Cullin3 and hypothetical protein C52B11.2 184281 N/A 184290 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184285 unspecified role unspecified role bait bait Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cul3-mel_26 GST pulldown analysis reveals interaction between Cullin3 and hypothetical protein ZK858.2 184281 N/A 184285 unspecified role unspecified role bait bait Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184297 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cul3-p34371-1 GST pulldown analysis reveals interaction between Cullin3 and hypothetical protein C50C3.8 184281 N/A 184285 unspecified role unspecified role bait bait Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184292 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cul3-q9nf14-1 GST pulldown analysis reveals interaction between Cullin3 and hypothetical protein Y105E8B.4 184281 N/A 184285 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184293 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mei_1-mel_26-1 GST pulldown analysis reveals interaction between meiotic spindle formation protein (mei-1) and hypothetical protein ZK858.2 184281 N/A 184298 unspecified role unspecified role bait bait P34808-2:p.Pro99Leu Proline 99 Leucine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184297 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q94420:p.Cys94Tyr Cysteine 94 Tyrosine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mei_1-mel_26-2 Directed yeast two hybrid analysis reveals interaction between meiotic spindle formation protein (mei-1) and hypothetical protein ZK858.2 184282 N/A 184298 unspecified role unspecified role bait bait P34808-2:p.Pro99Leu Proline 99 Leucine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 184297 unspecified role unspecified role prey prey Q94420:p.Cys94Tyr Cysteine 94 Tyrosine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false cul3-q18776-2 Directed yeast 2 hybrid analysis reveals interaction between Cullin3 and hypothetical protein C52B11.2 184282 N/A 184285 unspecified role unspecified role bait bait Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 184290 unspecified role unspecified role prey prey physical association physical association false false false cul3-p34371-2 Directed yeast two hybrid analysis reveals interaction between Cullin3 and hypothetical protein C50C3.8 184282 N/A 184292 unspecified role unspecified role prey prey N/A 184285 unspecified role unspecified role bait bait Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false cul3-mel_26-1 Directed yeast two hybrid analysis reveals interaction between Cullin3 and hypothetical protein ZK858.2 184282 N/A 184285 unspecified role unspecified role bait bait Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 184297 unspecified role unspecified role prey prey physical association physical association false false false mel26-cul3 Yeast 2 hybrid analysis reveals interaction between hypothetical protein ZK858.2 and Cullin3 184283 N/A 184297 unspecified role unspecified role bait bait N/A 184299 unspecified role unspecified role prey prey N/A 184285 unspecified role unspecified role prey prey association association false false false mei_1-mel_26-3 GST pulldown analysis reveals interaction between meiotic spindle formation protein (mei-1) and hypothetical protein ZK858.2 184284 N/A 184297 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184298 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false