IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mitsuzawa-2003-1 Rpb7 subunit of RNA polymerase II interacts with an RNA-binding protein involved in processing of transcripts. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mitsuzawa H., Kanda E., Ishihama A. Fig 2, 6B hmitsuza@lab.nig.ac.jp Nucleic Acids Res. (0305-1048) 2003 mitsuzawa-2003-2 Rpb7 subunit of RNA polymerase II interacts with an RNA-binding protein involved in processing of transcripts. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mitsuzawa H., Kanda E., Ishihama A. Fig 2, 6B hmitsuza@lab.nig.ac.jp Nucleic Acids Res. (0305-1048) 2003 mitsuzawa-2003-3 Rpb7 subunit of RNA polymerase II interacts with an RNA-binding protein involved in processing of transcripts. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mitsuzawa H., Kanda E., Ishihama A. Fig 2, 6B hmitsuza@lab.nig.ac.jp A Gal4AD-fused S. pombe cDNA library was used Nucleic Acids Res. (0305-1048) 2003 seb1_schpo Rpb7-binding protein seb1 seb1 SPAC222.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSGIAEFDGILDSLEHSKTGISGSKILKLTNLSMENVSENAQFVASVYKYAKRAPVTHKLGALYILDSIVRSFQDGAKKNNESFENPVDASFSGGWCKAAEITDSLVADAIQHAPSAHLPKILKLCDIWEKASTFPPEKLESLRSKLKDAMASTEPVSVDSAAAPSQSTNPEGNGGSVGSQAAAPTSRPVENDAASILEALAAFAQKAPVPSAAEESVSTPPQPAVAPSVSAVVPNLPVHPATAINAQSQSGNPLSNPLFQPSNVPQSIPSGPMGMKTGSVNDTQSQQITLMNVLASQNVPPAQIDSIMKAAFPNYNAPFQPAGVGSVPLPAPTSSQSLRLGSLHRSRSPSPRSGRPRRSPSPSHLSIPSTLPPADGVPKPTPDGFPRRFERDPTIPPDSIKVYSRTLFLGGITRSVREPVLRSMFERFGSVQSLILNHNYRHGFLKMFRRDAAEKAQVAMENVPFADTTIRTKWGVGFGPRECSDFSTGISVIPIRLLTDADRTWLVTAEYGGTGGLPITPGIALDEPDIEIGLGISSKAISKRGKDFAMRRDERFRGRKPYRGGPPIHHGERHFDSGNDWHGNPSTVPPPTNPYNPGYPYMDPNYSSGYVSQPPWQPQ rpb7_schpo DNA-directed RNA polymerase II subunit rpb7 rpb7 SPACUNK4.06c SPAPYUK71.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPFFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL act_schpo Actin act1 cps8 SPBC32H8.12c pi012 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNREKMTQIIFETFNAPAFYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILMERGYTFSTTAEREIVRDIKEKLCYVALDFEQELQTAAQSSSLEKSYELPDGQVITIGNERFRAPEALFQPSALGLENAGIHEATYNSIMKCDVDIRKDLYGNVVMSGGTTMYPGIADRMQKEIQALAPSSMKVKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVYRKCF rpb7_yeast DNA-directed RNA polymerase II subunit RPB7 RPB7 YDR404C D9509.22 B16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI 44C85603A93CDE67 nrd1_yeast Protein NRD1 N0868 YNL251C NRD1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQQDDDFQNFVATLESFKDLKSGISGSRIKKLTTYALDHIDIESKIISLIIDYSRLCPDSHKLGSLYIIDSIGRAYLDETRSNSNSSSNKPGTCAHAINTLGEVIQELLSDAIAKSNQDHKEKIRMLLDIWDRSGLFQKSYLNAIRSKCFAMDISNNTANTASQQLSLDPKQRSKQILSNLKKSPPLNLNISLPTDLTSTDPAKQQAALFQVIAALQKHFKTLPSHTSVGTVAPPQAHTITEYGSRRERERERERYNSRRNRSRSPPAPFSQPSTGRKDRYPSVAQDQYSIGAPNTTFGTNNHHLYPDELNVSNNPHYRPKPVSYDSTLPPDHIKVYSRTLFIGGVPLNMKEWDLANVLKPFAEVQSVILNNSRKHAFVKVYSRHEAENVLQNFNKDGALPLRTRWGVGFGPRDCCDYQHGYSIIPMHRLTDADKKWSVSAQWGGTSGQPLVTGIVFEEPDIIVGEGVSSKAISQKMPTDSGRNGPRSGKPNKSGSISSISPVPYGNAPLASPPPQQYVQPMMQQPYGYAPNQPLPSQGPAAAAPPVPQQQFDPTAQLNSLMNMLNQQQQQQQQS 75082BDB0C42AE37 seb1-rpb7-1 Interaction of seb1(bait) and rpb7 (prey) of Schizosaccharomyces pombe 194890 N/A 194893 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 194894 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O14459:p.Glu166_Asp167delinsArgAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false seb1-act1-1 Interaction of seb1(bait) and act1 (prey) of Schizosaccharomyces pombe 194890 N/A 194893 unspecified role unspecified role bait bait N/A 194895 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false nrd1-rpb7-1 Interaction of seb1(bait) and rpb7 (prey) of Saccharomyces cerevisiae 194890 N/A 194896 unspecified role unspecified role prey prey N/A 194897 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false seb1-rpb7-2 Interaction of seb1(bait) and rpb7 (prey) of Schizosaccharomyces pombe via GST pull down 194891 N/A 194894 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 194893 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false rpb7-seb1-1 Interaction between Schizosaccharomyces pombe rpb7 (bait) and seb1 (prey) 194892 N/A 194893 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 194894 unspecified role unspecified role bait bait physical association physical association false false false