IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ toledo_orti-2003-1 The Arabidopsis basic/helix-loop-helix transcription factor family. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Toledo-Ortiz G., Huq E., Quail PH. Directed yeast two hybrid assay. Figure 5 (a). quail@nature.berkeley.edu Plant Cell (1040-4651) 2003 toledo_orti-2003-2 The Arabidopsis basic/helix-loop-helix transcription factor family. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Toledo-Ortiz G., Huq E., Quail PH. Directed yeast two hybrid assay. Figure 5 (a). quail@nature.berkeley.edu Plant Cell (1040-4651) 2003 q8w2f3-2 Transcription factor PIF4 PIF4 BHLH9 EN102 SRL2 Basic helix-loop-helix protein 9 Phytochrome-interacting factor 4 Short under red-light 2 Transcription factor EN 102 bHLH transcription factor bHLH009 MFL8.13 At2g43010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEHQGWSFEENYSLSTNRRSIRPQDELVELLWRDGQVVLQSQTHREQTQTQKQDHHEEALRSSTFLEDQETVSWIQYPPDEDPFEPDDFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPPPKFRLTNSSSGIRETEMEQYSVTTVGPSHCGSNPSQNDLDVSMSHDRSKNIEEKLNPNASSSSGGSSGCSFGKDIKEMASGRCITTDRKRKRINHTDESVSLSDAIGNKSNQRSGSNRRSRAAEVHNLSERVLHRFVYIIYNI pif3_arath Transcription factor PIF3 Phytochrome-associated protein 3 Basic helix-loop-helix protein 8 PIF3 PAP3 BHLH8 At1g09530 F14J9.19 Transcription factor EN 100 bHLH transcription factor bHLH008 Phytochrome-interacting factor 3 EN100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPLFELFRLTKAKLESAQDRNPSPPVDEVVELVWENGQISTQSQSSRSRNIPPPQANSSRAREIGNGSKTTMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPSLDGYCSDFLRDVSSPVTVNEQESDMAVNQTAFPLFQRRKDGNESAPAASSSQYNGFQSHSLYGSDRARDLPSQQTNPDRFTQTQEPLITSNKPSLVNFSHFLRPATFAKTTNNNLHDTKEKSPQSPPNVFQTRVLGAKDSEDKVLNESVASATPKDNQKACLISEDSCRKDQESEKAVVCSSVGSGNSLDGPSESPSLSLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQIMSMASGYYLPPAVMFPPGMGHYPAAAAAMAMGMGMPYAMGLPDLSRGGSSVNHGPQFQVSGMQQQPVAMGIPRVSGGGIFAGSSTIGNGSTRDLSGSKDQTTTNNNSNLKPIKRKQGSSDQFCGSS pif3-pif4 Directed yeast-2-hybrid reveals interaction between PIF3 protein and the PIF4 protein 204504 N/A 204506 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 204507 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false pif3-pif3 Direced yeast-2-hybrid reveals homotypic interaction between PIF3 protein and the PIF4 protein 204504 N/A 204507 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 204507 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false pif3-pif4-1 Anti tag coimmunoprecipitation reveals interaction between PIF3 protein and the PIF4 protein 204505 N/A 204507 unspecified role unspecified role bait bait s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gad GAL activation domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 204506 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false pif4-pif3 Anti tag coimmunoprecipitation reveals interaction between PIF4 protein and the PIF3 protein 204505 N/A 204507 unspecified role unspecified role prey prey s35 radiolabelled tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 204506 unspecified role unspecified role bait bait s35 radiolabelled tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gad GAL activation domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false