IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ naver-2001-1 Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 Plant Cell (1040-4651) 2001 naver-2001-3 Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 Plant Cell (1040-4651) 2001 naver-2001-2 Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 Plant Cell (1040-4651) 2001 naver-2001-4 Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. chlre Chlamydomonas reinhardtii Chlamydomonas smithii biochemical biochemical western blot western blot Immuno blot Immuno blot Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 Plant Cell (1040-4651) 2001 psac_chlre Photosystem I iron-sulfur center Photosystem I subunit VII 9 kDa polypeptide PSI-C PsaC psaC protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MAHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY psae_chlre Photosystem I reaction center subunit IV, chloroplastic Photosystem I 8.1 kDa protein P30 protein PSAE protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MQALSSRVNIAAKPQRAQRLVVRAEEVKAAPKKEVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAAK psaf_chlre Photosystem I reaction center subunit III, chloroplastic Light-harvesting complex I 17 kDa protein PSI-F P21 protein PSAF protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MALTMRNPAVKASSRVAPSSRRALRVACQAQKNETASKVGTALAASALAAAVSLSAPSAAMADIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR psaa_chlre Photosystem I P700 chlorophyll a apoprotein A1 psaA ps1a1 PSI-A PsaA protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MTISTPEREAKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG psad_chlre Photosystem I reaction center subunit II, chloroplastic Photosystem I 20 kDa subunit psaD protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MAVMMRTQAPAATRASSRVAVAARPAARRAVVVRAEAEAAPAAAKKAAEKPAWTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI psab_chlre Photosystem I P700 chlorophyll a apoprotein A2 PsaB PSI-B psaB ps1a2 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MATKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFG ycf3_chlre Photosystem I assembly protein Ycf3 ycf3 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MPRTQRNDNFIDKTFTVVADILLKVLPTSQREKQAFSYYRNGMSAQAEGEYAEALQNYYEAMRLEVDAYDRSYILYNIGLIHTSNGEHGRALEYYYQALERNPSLSSALNNIAVIYHYRGEQAIENGQSEISQILFEKAADYWKEAIRLAPTNYIEALNWLKMTGRLTGLAT psag_chlre Photosystem I reaction center subunit V, chloroplastic PSI-G Light-harvesting complex I 10 kDa protein P35 protein PSAG protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MQTLASRPSLRASARVAPRRAPRVAVVTKAALDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANLS psaa-psae-1 Co-IP: bait = Chlamydomonas reinhardtii PsaA, Preys = PsaC, PsaD, PsaE, PsaF, PsaL 188490 N/A 188494 unspecified role unspecified role prey prey N/A 188495 unspecified role unspecified role prey prey N/A 188496 unspecified role unspecified role prey prey N/A 188497 unspecified role unspecified role bait bait N/A 188498 unspecified role unspecified role prey prey association association false false false psab-psac-1 Co-IP: bait = Chlamydomonas reinhardtii PsaB, Preys = PsaC, PsaD, PsaF, PsaL 188490 N/A 188499 unspecified role unspecified role bait bait N/A 188496 unspecified role unspecified role prey prey N/A 188498 unspecified role unspecified role prey prey N/A 188494 unspecified role unspecified role prey prey association association false false false psac-psad-1 Co-IP: bait = Chlamydomonas reinhardtii PsaC, Preys = PsaD, PsaF 188490 N/A 188496 unspecified role unspecified role prey prey N/A 188494 unspecified role unspecified role bait bait N/A 188498 unspecified role unspecified role prey prey association association false false false psad-psac-1 Co-IP: bait = Chlamydomonas reinhardtii PsaD, Preys = PsaC, PsaF 188490 N/A 188496 unspecified role unspecified role prey prey N/A 188494 unspecified role unspecified role prey prey N/A 188498 unspecified role unspecified role bait bait association association false false false psae-psaf-1 Co-IP: bait = Chlamydomonas reinhardtii PsaE, prey = PsaF 188490 N/A 188495 unspecified role unspecified role bait bait N/A 188496 unspecified role unspecified role prey prey physical association physical association false false false psaf-psad-1 Co-IP: bait = Chlamydomonas reinhardtii PsaF, Preys = PsaD, PsaL 188490 N/A 188498 unspecified role unspecified role prey prey N/A 188496 unspecified role unspecified role bait bait physical association physical association false false false ycf3-psaa-1 Co-IP: bait = Chlamydomonas reinhardtii Ycf3, preys = PsaA, PsaB, PsaC, PsaD, PsaE, PsaF, PsaL 188490 N/A 188497 unspecified role unspecified role prey prey N/A 188499 unspecified role unspecified role prey prey N/A 188495 unspecified role unspecified role prey prey N/A 188500 unspecified role unspecified role bait bait N/A 188494 unspecified role unspecified role prey prey N/A 188496 unspecified role unspecified role prey prey N/A 188498 unspecified role unspecified role prey prey association association false false false Ycf3 may interact directly only with the PSI subunits, psaA and psaD as shown in other experiments. Ycf3 is necessary for PSI assembly but is not found in the final PSI complex. psaa-ycf3-1 Co-IP: bait = Chlamydomonas reinhardtii PsaA, Prey = Ycf3 188490 N/A 188500 unspecified role unspecified role prey prey N/A 188497 unspecified role unspecified role bait bait physical association physical association false false false psad-ycf3-1 Co-IP: bait = Chlamydomonas reinhardtii PsaD, prey = Ycf3 188490 N/A 188498 unspecified role unspecified role bait bait N/A 188500 unspecified role unspecified role prey prey physical association physical association false false false psac-psad-2 Co-IP: bait = Chlamydomonas reinhardtii PsaC, Preys = PsaD, Ycf3 188491 N/A 188500 unspecified role unspecified role prey prey N/A 188494 unspecified role unspecified role bait bait N/A 188498 unspecified role unspecified role prey prey association association false false false psad-psac-2 Co-IP: bait = Chlamydomonas reinhardtii PsaD, Preys = PsaC, Ycf3 188491 N/A 188498 unspecified role unspecified role bait bait N/A 188500 unspecified role unspecified role prey prey N/A 188494 unspecified role unspecified role prey prey association association false false false psae-psad-2 Co-IP: bait = Chlamydomonas reinhardtii PsaE, prey = PsaD, Ycf3 188491 N/A 188495 unspecified role unspecified role bait bait N/A 188498 unspecified role unspecified role prey prey N/A 188500 unspecified role unspecified role prey prey association association false false false ycf3-psaa-2 Co-IP: bait = Chlamydomonas reinhardtii Ycf3, preys = PsaC, PsaD, PsaE 188491 N/A 188500 unspecified role unspecified role bait bait N/A 188495 unspecified role unspecified role prey prey N/A 188494 unspecified role unspecified role prey prey N/A 188498 unspecified role unspecified role prey prey association association false false false Ycf3 is necessary for PSI assembly but is not found in the final PSI complex. psaa-ycf3-2 Far western blotting: bait = Chlamydomonas reinhardtii Ycf3, prey = PsaA 188492 N/A 188500 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 188497 unspecified role unspecified role prey prey physical association physical association false false false psaa-psaf-1 Chlamydomonas reinhardtii Photosystem I (PSI) purification from thylakoid membranes 188493 N/A 188501 unspecified role unspecified role neutral component neutral component N/A 188498 unspecified role unspecified role neutral component neutral component N/A 188497 unspecified role unspecified role neutral component neutral component N/A 188495 unspecified role unspecified role neutral component neutral component N/A 188494 unspecified role unspecified role neutral component neutral component N/A 188496 unspecified role unspecified role neutral component neutral component physical association physical association false false false