IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fu-2001-1 Subunit interaction maps for the regulatory particle of the 26S proteasome and the COP9 signalosome. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu H., Reis N., Lee Y., Glickman MH., Vierstra RD. Figure 8 provides a diagram of proposed interaction maps from data. Directed yeast two hybrid assay using HIS3 and LacZ reporter genes was employed in this study. Figure 1. Figure 2. Figure 3. hongyong@gate.sinica.edu.tw EMBO J. (0261-4189) 2001 IMEx Only protein-protein interactions imex curation imex curation fu-2001-2 Subunit interaction maps for the regulatory particle of the 26S proteasome and the COP9 signalosome. in vitro In vitro chromatography chromatography technology column chromatography chromatography western blot western blot Immuno blot Immuno blot Fu H., Reis N., Lee Y., Glickman MH., Vierstra RD. Figure 8 provides a diagram of proposed interaction maps from data. Directed yeast two hybrid assay using HIS3 and LacZ reporter genes was employed in this study. Figure 1. Figure 2. Figure 3. hongyong@gate.sinica.edu.tw EMBO J. (0261-4189) 2001 IMEx Only protein-protein interactions imex curation imex curation prs7_yeast 26S proteasome regulatory subunit 7 homolog YKL145W RPT1 CIM5 YTA3 Protein CIM5 Tat-binding homolog 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 8454BBC9D549EC5C prs4_yeast 26S proteasome regulatory subunit 4 homolog RPT2 YHS4 YTA5 YDL007W D2920 Tat-binding homolog 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGQGVSSGQDKKKKKGSNQKPKYEPPVQSKFGRKKRKGGPATAEKLPNIYPSTRCKLKLLRMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL EB735354C3A0EBD4 prs6b_yeast 26S proteasome regulatory subunit 6B homolog RPT3 YNT1 YTA2 YDR394W D9509.14 Protein YNT1 Tat-binding homolog 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEELGIVTPVEKAVEEKPAVKSYASLLAQLNGTVNNNSALSNVNSDIYFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK E12F0995A60732BD prs6a_yeast 26S proteasome regulatory subunit 6A RPT5 YTA1 YOR117W O3258 YOR3258W Tat-binding protein homolog 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA C215422033FCE830 prs8_yeast 26S proteasome regulatory subunit 8 homolog TBPY TBY1 YGL048C RPT6 CIM3 CRL3 SUG1 Protein SUG1 Protein CIM3 Tat-binding protein TBY1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 9C59E92A0794F60F prs10_yeast 26S proteasome subunit RPT4 RPT4 CRL13 PCS1 SUG2 26S protease subunit SUG2 Proteasomal cap subunit YOR259C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEQDPLLAGLGETSGDNHTQQSHEQQPEQPQETEEHHEEEPSRVDPEQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL 0EA42A599E2B2E2A rpn1_yeast 26S proteasome regulatory subunit RPN1 RPN1 HRD2 NAS1 RPD1 Proteasome non-ATPase subunit 1 HMG-CoA reductase degradation protein 2 YHR027C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDESDKKQQTIDEQSQISPEKQTPNKKDKKKEEEEQLSEEDAKLKTDLELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADVLSILAMTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSAATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQDIIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDKLIVDNDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVEPALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTGDVLLIQDLLHRLTPKNVKGEEDADEEETAEGQTNSISDFLGEQVNEPTKNEEAEIEVDEMEVDAEGEEVEVKAEITEKKNGESLEGEEIKSEEKKGKSSDKDATTDGKNDDEEEEKEAGIVDELAYAVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDPQMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLGKGTMTMDVFNDAHVLNKVTLASILTTAVGLVSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVRVGQAVETVGQAGRPKKITGWITQSTPVLLNHGERAELETDEYISYTSHIEGVVILKKNPDYREEE B77954F4A998BA7C rpn3_yeast 26S proteasome regulatory subunit RPN3 RPN3 SUN2 YER021W protein protein yeast Saccharomyces cerevisiae Baker's yeast MASTAVMMDVDSSGVNDLHHSEKKYAEEDQVQELLKVLNEISKTTLTLDPRYIWRSLKDLSSLRNQELLNAETLCFTVNVLYPDSSSFKKNLLKFITSNHKSSVPGSAELRNSYPASFYSVNTEKKTIEVTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDKKTQQNEKSENGENDDDTLDGDLMDDMSDISDLDDLGFL B08B58663DDA85DC rpn7_yeast 26S proteasome regulatory subunit RPN7 RPN7 P8283.8 YPR108W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRLTGSDRV B21B66CD818E636D rpn5_yeast 26S proteasome regulatory subunit RPN5 RPN5 NAS5 YDL147W D1572 Proteasome non-ATPase subunit 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK E5DC7F8E6AE27736 rpn6_yeast 26S proteasome regulatory subunit RPN6 RPN6 NAS4 YDL097C D2381 Proteasome non-ATPase subunit 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVLY A8B1F7E6F73A4024 rpn8_yeast 26S proteasome regulatory subunit RPN8 RPN8 O5360 YOR261C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKDKQSKVSDDSESESGDKEATAPLIQRKNKKN 6EE6009545A3D0EF rpn9_yeast 26S proteasome regulatory subunit RPN9 RPN9 NAS7 YDR427W D9461.14 Proteasome non-ATPase subunit 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEARGQSIWV 540F7DF8C23469A1 rpn11_yeast Ubiquitin carboxyl-terminal hydrolase RPN11 YFR004W RPN11 MPR1 Protein MPR1 26S proteasome regulatory subunit RPN11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK 9DDE8BD74890894D rpn12_yeast 26S proteasome regulatory subunit RPN12 RPN12 NIN1 Nuclear integrity protein 1 YFR052W protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSLAELTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIENIV D901AAD4D07ED3D1 csn1_arath COP9 signalosome complex subunit 1 Constitutive photomorphogenesis protein 11 Protein FUSCA 6 CSN1 COP11 FUS6 At3g61140 T20K12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDEEASGPMMEMCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDVRAMLLRANLLKHEYHARSARKL q94ju3-1 COP9 signalosome complex subunit 7 CSN7ii CSN7 FUS5 Protein FUSCA 5 T7I23.24 T7I23.25 At1g02090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIEQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKKHRKEAEEGVEEVKKSLSMKGDVDIRGNKEMFGEPSGVMDYEEDGIRPKRRRHPVTR q94ju3-2 COP9 signalosome complex subunit 7 CSN7i CSN7 FUS5 Protein FUSCA 5 T7I23.24 T7I23.25 At1g02090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIEQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKKHRKEAEEGVEEVKKSLSMKRE csn3_arath COP9 signalosome complex subunit 3 Protein FUSCA 11 CSN3 FUS11 At5g14250 F18O22.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGAVNSVEAVITSIQGLSGSPEDLSALHDLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLYFLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLRGVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEIDQPRDFFLYSYYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKCASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFEEDKNLGLVKQAVSSLYKRNILRLTQKYLTLSLQDIANMVQLGNAKEAEMHVLQMIQDGQIHALINQKDGMVRFLEDPEQYKSSEMIEIMDSVIQRTIGLSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM csn4_arath COP9 signalosome complex subunit 4 Constitutive photomorphogenesis protein 8 Protein FUSCA 4 CSN4 COP8 FUS4 At5g42970 MBD2.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQSFAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLSGIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYKVCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLDRAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQEEAVIHFEDDVEELQQWDQQISGLCQALNDILDGMAKKGMSVPV csn5b_arath COP9 signalosome complex subunit 5b CSN5B AJH2 CSN5A Jun activation domain-binding homolog 2 F3I17.12 At1g71230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSSTIARKTWELENSILTVDSPDSTSDNIFYYDDTSQTRFQQEKPWENDPHYFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQDDAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQQHQEPFLAVVIDPTRTVSAGKVEIGAFRTYSKGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVPSSLHKKKEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDPMITY csn5a_arath COP9 signalosome complex subunit 5a CSN5A AJH1 CSN5B Jun activation domain-binding homolog 1 F19G10.12 At1g22920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSSAIARKTWELENNILPVEPTDSASDSIFHYDDASQAKIQQEKPWASDPNYFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQSDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGGIAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEPMITS csn8_arath COP9 signalosome complex subunit 8 Constitutive photomorphogenesis protein 9 Protein FUSCA 7 CSN8 COP9 FUS7 At4g14110 dl3095c protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH csn6a_arath COP9 signalosome complex subunit 6a CSN6A At5g56280 K24C1.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPSSSSGLTFKLHPLVIVNISDHYTRVKTQLNPPASICASGHGSNNGEAMFQQNPRVYGCVIGVQRGRTVEIFNSFELLYDPSTQTLDRSFLEKKQELYKKVFPDFYILGWYSTGSDAEESDMHIHKALMDINESPVYVLLNPAINHTQKDLPVTIYESELHVIDGIPQLIFAHTSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLNSRIRVLYQNLAAMQKGDKSCDNSVLRQVSSLLRRLPAMESERFQDNFLMEYNDKLLITYLAMITNCSSNMNEMVDKFNTAYDRNTRRGGRTAFM csn6b_arath COP9 signalosome complex subunit 6b CSN6B At4g26430 M3E9.140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPSSSSGLTFKLHPLVMLNISDHFTRVKTQLNPPAASCATGNGSNNADAMLLQNPRVYGCVIGLQRGRTVEIFNSFELIFDPALDTLDRSFLEKKQELYKKVFPDFYVLGWYSTGSDATESDMHIHKALMDINESPVYVLLNPAINHAQKDLPVTIYESEFHVIDGIPQSIFVHTSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLNSRIRVLYQHIVAMQKGDKPCENSVLRQVSSLLRSLPAAESEKFNENFLMEYNDKLLMSYLAMITNCTSNMNEVVDKFNTAYDKHSRRGGRTAFM rpn10_yeast 26S proteasome regulatory subunit RPN10 RPN10 MCB1 SUN1 YHR200W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPIILEEGSSGMGAFGGSGGDSDANGTFMDFGVDPSMDPELAMALRLSMEEEQQRQERLRQQQQQQDQPEQSEQPEQHQDK 8A05198B0CD7C0C3 rpt1-rpt2-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt1 and Rpt2 219034 N/A 219036 unspecified role unspecified role bait bait N/A 219037 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpt3-rpt3-1 Directed yeast-2-hybrid reveals homotypic interaction of the 19S regulatory particle subunit Rpt3 219034 N/A 219038 unspecified role unspecified role bait bait N/A 219038 unspecified role unspecified role prey prey physical association physical association false false false Low HIS3 reporter activity when binding domain fused to N-terminal of RPT3 protein. LacZ reporter acivity detected. rpt3-rpt5-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt3 and Rpt5 219034 N/A 219038 unspecified role unspecified role bait bait N/A 219039 unspecified role unspecified role prey prey physical association physical association false false false Low HIS3 reporter activity detected when binding domain fused to N-terminal of RPT3 protein. LacZ reporter acivity detected. rpt3-rpt6-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt3 and Rpt6 219034 N/A 219040 unspecified role unspecified role prey prey c terminal binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q01939:p.Lys195Arg Lys195Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q01939:p.Lys195Ser Lys195ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 219038 unspecified role unspecified role bait bait physical association physical association false false false Both HIS3 and LacZ reporter activity detected. rpt4-rpt5-4 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt4 and Rpt5 219034 N/A 219039 unspecified role unspecified role prey prey N/A 219041 unspecified role unspecified role bait bait physical association physical association false false false Both HIS3 and LacZ reporter acitivity detected. rpt1-rpn1-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt1 and Rpn1 219034 N/A 219042 unspecified role unspecified role prey prey N/A 219036 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpt2-rpt1-3 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt2 and Rpt1 219034 N/A 219036 unspecified role unspecified role prey prey N/A 219037 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpn1-rpt1-26 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn1 and Rpt1 219034 N/A 219036 unspecified role unspecified role prey prey N/A 219042 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpt5-rpt3-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt5 and Rpt3 219034 N/A 219039 unspecified role unspecified role bait bait N/A 219038 unspecified role unspecified role prey prey physical association physical association false false false Both HIS3 and LacZ reporter acitivity detected. rpt6-rpt3-20 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt6 and Rpt3 219034 N/A 219038 unspecified role unspecified role prey prey N/A 219040 unspecified role unspecified role bait bait physical association physical association false false false Both HIS3 and LacZ reporter activity detected. rpt5-rpt4-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpt5 and Rpt4 219034 N/A 219039 unspecified role unspecified role bait bait N/A 219041 unspecified role unspecified role prey prey c terminal binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false rpn3-rpn7-8 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn3 and Rpn7 219034 N/A 219043 unspecified role unspecified role bait bait N/A 219044 unspecified role unspecified role prey prey physical association physical association false false false Rpn3 was shown to self-activate the HIS3 reporter. LacZ reporter activity detected. rpn7-rpn3-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn7 and Rpn3 219034 N/A 219044 unspecified role unspecified role bait bait N/A 219043 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false rpn5-rpn6-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn5 and Rpn6 219034 N/A 219045 unspecified role unspecified role bait bait N/A 219046 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpn6-rpn5-17 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn6 and Rpn5 219034 N/A 219045 unspecified role unspecified role prey prey N/A 219046 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpn5-rpn8-13 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn5 and Rpn8 219034 N/A 219047 unspecified role unspecified role prey prey N/A 219045 unspecified role unspecified role bait bait physical association physical association false false false LacZ reporter activity not detected. HIS3 reporter acivity detected. rpn8-rpn5-7 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn8 and Rpn5 219034 N/A 219045 unspecified role unspecified role prey prey N/A 219047 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpn5-rpn9-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn5 and Rpn9 219034 N/A 219045 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 219048 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false rpn9-rpn5-6 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn9 and Rpn5 219034 N/A 219045 unspecified role unspecified role prey prey N/A 219048 unspecified role unspecified role bait bait physical association physical association false false false rpn5-rpn11-13 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn5 and Rpn11 219034 N/A 219045 unspecified role unspecified role bait bait N/A 219049 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth (in BD linked to C terminal of protein configuration) and LacZ reporter activity not detected rpn11-rpn5-3 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn11 and Rpn5 219034 N/A 219045 unspecified role unspecified role prey prey N/A 219049 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpn8-rpn9-7 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn8 and Rpn9 219034 N/A 219047 unspecified role unspecified role bait bait N/A 219048 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth (in BD fused to N terminal of protein configuration) and LacZ reporter activity not detected rpn9-rpn8-5 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn9 and Rpn8 219034 N/A 219047 unspecified role unspecified role prey prey N/A 219048 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpn8-rpn11-6 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn8 and Rpn11 219034 N/A 219047 unspecified role unspecified role bait bait N/A 219049 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth when binding domain fused to C-terminal of Rpn8 protein. LacZ reporter detected. rpn11-rpn8-2 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn11 and Rpn8 219034 N/A 219049 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 219047 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false HIS3 and LacZ reporter activity detected. rpn9-rpn11-1 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn9 and Rpn11 219034 N/A 219048 unspecified role unspecified role bait bait N/A 219049 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpn11-rpn9-4 Directed yeast-2-hybrid reveals interaction between 19S regulatory particle subunits Rpn11 and Rpn9 219034 N/A 219049 unspecified role unspecified role bait bait N/A 219048 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth and LacZ reporter activity not detected rpt12-rpt3-1 Directed yeast-2-hybrid reveals interaction of the 19S regulatory particle subunits Rpt12 and Rpt3 219034 N/A 219050 unspecified role unspecified role bait bait N/A 219038 unspecified role unspecified role prey prey physical association physical association false false false Rpn3 fused to binding domain showed self activation of the HIS3 reporter. LacZ reporter activity was not detected. csn1-csn7i-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN1and CSN7i 219034 N/A 219051 unspecified role unspecified role bait bait N/A 219052 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth. LacZ reporter activity not detected csn1-csn7ii-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN1and CSN7ii 219034 N/A 219053 unspecified role unspecified role prey prey N/A 219051 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth. LacZ reporter activity not detected csn3-csn4-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN3 and CSN4 219034 N/A 219054 unspecified role unspecified role bait bait N/A 219055 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth when Csn3 protein N terminal domain fused to binding domain. LacZ reporter activity not detected csn4-csn3-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN4 and CSN3 219034 N/A 219055 unspecified role unspecified role bait bait N/A 219054 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth when Csn4 N terminal fused to inding domain. LacZ reporter activity not detected csn3-csn5a-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN3 and CSN5A 219034 N/A 219056 unspecified role unspecified role prey prey N/A 219054 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth when Csn3 N terminal domain fused to binding domain. LacZ reporter activity not detected csn3-csn5b-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN3 and CSN5B 219034 N/A 219057 unspecified role unspecified role prey prey N/A 219054 unspecified role unspecified role bait bait physical association physical association false false false LacZ reporter activity not detected The CSN5B binding domain construct showed self activation of the HIS3 reporter. csn7i-csn3-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7i and CSN3 219034 N/A 219053 unspecified role unspecified role prey prey N/A 219054 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth when C terminal of Csn7i fused to binding domain. LacZ reporter activity not detected csn3-csn8-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN3 and CSN8 219034 N/A 219054 unspecified role unspecified role bait bait N/A 219058 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth. LacZ reporter activity detected. csn8-csn3-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN8 and CSN3 219034 N/A 219058 unspecified role unspecified role bait bait N/A 219054 unspecified role unspecified role prey prey physical association physical association false false false Low histidine auxotrophic growth when C terminal of Csn8 protein fused to binding domain. LacZ reporter activity detected. csn4-csn5a-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN4 and CSN5A 219034 N/A 219056 unspecified role unspecified role prey prey N/A 219055 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth detected when N terminal of Csn4 fused to binding domain. LacZ reporter activity not detected csn4-csn7i-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN4 and CSN7i 219034 N/A 219055 unspecified role unspecified role bait bait N/A 219052 unspecified role unspecified role prey prey physical association physical association false false false csn4-csn7ii-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN4 and CSN7ii 219034 N/A 219055 unspecified role unspecified role bait bait N/A 219053 unspecified role unspecified role prey prey physical association physical association false false false csn7i-csn4-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7i and CSN4 219034 N/A 219055 unspecified role unspecified role prey prey N/A 219052 unspecified role unspecified role bait bait physical association physical association false false false Both HIS3 and LacZ reporter activity detected. csn7ii-csn4-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7ii and CSN4 219034 N/A 219055 unspecified role unspecified role prey prey N/A 219053 unspecified role unspecified role bait bait physical association physical association false false false Both LacZ and HIS3 reporter acitivity detected. csn6a-csn5a-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN6A and CSN5A 219034 N/A 219059 unspecified role unspecified role bait bait N/A 219056 unspecified role unspecified role prey prey physical association physical association false false false The CSN5A binding domain construct showed self activation of the HIS3 reporter. csn6b-csn5a-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN6B and CSN5A 219034 N/A 219060 unspecified role unspecified role bait bait N/A 219056 unspecified role unspecified role prey prey physical association physical association false false false The CSN5A binding domain construct showed self activation of the HIS3 reporter. csn6a-csn5b-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN6A and CSN5B 219034 N/A 219057 unspecified role unspecified role prey prey N/A 219059 unspecified role unspecified role bait bait physical association physical association false false false The CSN5B binding domain construct showed self activation of the HIS3 reporter. csn6b-csn5b-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN6B and CSN5B 219034 N/A 219060 unspecified role unspecified role bait bait N/A 219057 unspecified role unspecified role prey prey physical association physical association false false false The CSN5B binding domain construct showed self activation of the HIS3 reporter. csn7i-csn5a-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7i and CSN5A 219034 N/A 219053 unspecified role unspecified role bait bait N/A 219056 unspecified role unspecified role prey prey physical association physical association false false false Histidine auxotropic growth detected. No LacZ reporter acitivity detected. csn7ii-csn5a-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7ii and CSN5A 219034 N/A 219056 unspecified role unspecified role prey prey N/A 219052 unspecified role unspecified role bait bait physical association physical association false false false Histidine auxotrophic growth detected. No LacZ reporter activity detected. csn7i-csn5b-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7i and CSN5B 219034 N/A 219053 unspecified role unspecified role bait bait N/A 219057 unspecified role unspecified role prey prey physical association physical association false false false Histidine auxotrophic growth detected. No LacZ reporter acitivity detected. csn7ii-csn5b-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7ii and CSN5B 219034 N/A 219057 unspecified role unspecified role prey prey N/A 219052 unspecified role unspecified role bait bait physical association physical association false false false Histidine auxotrophic growth detected. No LacZ reporter acitivity detected. csn8-csn5a-2 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN8 and CSN5A 219034 N/A 219058 unspecified role unspecified role bait bait N/A 219056 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity selected. csn8-csn5b-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN8 and CSN5B 219034 N/A 219057 unspecified role unspecified role prey prey N/A 219058 unspecified role unspecified role bait bait physical association physical association false false false LacZ and HIS3 reporter activity detected. csn6a-csn6a-1 Directed yeast two hybrid analysis reveals homotypic interaction of the proteasome subunit CSN6A 219034 N/A 219059 unspecified role unspecified role prey prey N/A 219059 unspecified role unspecified role bait bait physical association physical association false false false Histidine auxotrophic growth detected. No LacZ reporter activity detected. csn6a-csn7i-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN6A and CSN7i 219034 N/A 219059 unspecified role unspecified role bait bait N/A 219053 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn7i-csn6a-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7i and CSN6A 219034 N/A 219053 unspecified role unspecified role bait bait N/A 219059 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn6a-csn7ii-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN6A and CSN7ii 219034 N/A 219052 unspecified role unspecified role prey prey N/A 219059 unspecified role unspecified role bait bait physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn7ii-csn6a-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7ii and CSN6A 219034 N/A 219052 unspecified role unspecified role bait bait N/A 219059 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn6b-csn7i-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN6B and CSN7i 219034 N/A 219060 unspecified role unspecified role bait bait N/A 219053 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn7i-csn6b-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7i and CSN6B 219034 N/A 219053 unspecified role unspecified role bait bait N/A 219060 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn6b-csn7ii-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN6B and CSN7ii 219034 N/A 219060 unspecified role unspecified role bait bait N/A 219052 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn7ii-csn6b-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7ii and CSN6B 219034 N/A 219052 unspecified role unspecified role bait bait N/A 219060 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn7ii-csn8-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7ii and CSN8 219034 N/A 219058 unspecified role unspecified role prey prey N/A 219052 unspecified role unspecified role bait bait physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn8-csn7ii-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN8 and CSN7ii 219034 N/A 219058 unspecified role unspecified role bait bait N/A 219052 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn7i-csn8-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7i and CSN8 219034 N/A 219058 unspecified role unspecified role prey prey N/A 219053 unspecified role unspecified role bait bait physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn8-csn7i-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN8 and CSN7i 219034 N/A 219058 unspecified role unspecified role bait bait N/A 219053 unspecified role unspecified role prey prey physical association physical association false false false Both LacZ and HIS3 reporter activity detected. csn7i-csn1-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7i and CSN1 219034 N/A 219051 unspecified role unspecified role prey prey N/A 219052 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth when Csn7i C terminal region fused to binding domain. LacZ reporter activity not detected csn7ii-csn1-1 Directed yeast two hybrid analysis reveals interaction between proteasome subunits CSN7ii and CSN1 219034 N/A 219051 unspecified role unspecified role prey prey N/A 219053 unspecified role unspecified role bait bait physical association physical association false false false Low histidine auxotrophic growth when Csn7ii C terminal region fused to binding domain. LacZ reporter activity not detected rpn10-rpn3-5 Molecular sieving analysis of 26S proteasome integrity. 219035 N/A 219061 unspecified role unspecified role neutral component neutral component P38886:p.Asp11Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 219036 unspecified role unspecified role neutral component neutral component N/A 219043 unspecified role unspecified role neutral component neutral component physical association physical association false false false