IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mansour-2001-2 Characterization of functional interactions among the Escherichia coli mismatch repair proteins using a bacterial two-hybrid assay. ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Mansour CA., Doiron KM., Cupples CG. Interaction was checked by assaying for beta-galactosidase. fig 1a claire@vax2.concordia.ca Mutat. Res. (0027-5107) 2001 mansour-2001-1 Characterization of functional interactions among the Escherichia coli mismatch repair proteins using a bacterial two-hybrid assay. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mansour CA., Doiron KM., Cupples CG. Interaction was checked by assaying for beta-galactosidase. fig 1a claire@vax2.concordia.ca Mutat. Res. (0027-5107) 2001 vsr_ecoli Very short patch repair protein DNA mismatch endonuclease Vsr mismatch endonuclease V.EcoKDcm vsr b1960 JW1943 protein protein ecoli Escherichia coli (strain K12) MADVHDKATRSKNMRAIATRDTAIEKRLASLLTGQGLAFRVQDASLPGRPDFVVDEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIVWECALRGREKLTDEALTERLEEWICGEGASAQIDTQGIHLLA mutl_ecoli DNA mismatch repair protein MutL mutL b4170 JW4128 protein protein ecoli Escherichia coli (strain K12) MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQLETPLPLDDEPQPAPRSIPENRVAAGRNHFAEPAAREPVAPRYTPAPASGSRPAAPWPNAQPGYQKQQGEVYRQLLQTPAPMQKLKAPEPQEPALAANSQSFGRVLTIVHSDCALLERDGNISLLSLPVAERWLRQAQLTPGEAPVCAQPLLIPLRLKVSAEEKSALEKAQSALAELGIDFQSDAQHVTIRAVPLPLRQQNLQILIPELIGYLAKQSVFEPGNIAQWIARNLMSEHAQWSMAQAITLLADVERLCPQLVKTPPGGLLQSVDLHPAIKALKDE muth_ecoli DNA mismatch repair protein MutH mutH mutR prv b2831 Methyl-directed mismatch repair protein JW2799 protein protein ecoli Escherichia coli (strain K12) MSQPRPLLSPPETEEQLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGWIGVLLEIWLGASAGSKPEQDFAALGVELKTIPVDSLGRPLETTFVCVAPLTGNSGVTWETSHVRHKLKRVLWIPVEGERSIPLAQRRVGSPLLWSPNEEEDRQLREDWEELMDMIVLGQVERITARHGEYLQIRPKAANAKALTEAIGARGERILTLPRGFYLKKNFTSALLARHFLIQ muts_ecoli DNA mismatch repair protein MutS mutS fdv b2733 JW2703 protein protein ecoli Escherichia coli (strain K12) MSAIENFDAHTPMMQQYLRLKAQHPEILLFYRMGDFYELFYDDAKRASQLLDISLTKRGASAGEPIPMAGIPYHAVENYLAKLVNQGESVAICEQIGDPATSKGPVERKVVRIVTPGTISDEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEPADRETMAAELQRTNPAELLYAEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCLLQYAKDTQRTTLPHIRSITMEREQDSIIMDAATRRNLEITQNLAGGAENTLASVLDCTVTPMGSRMLKRWLHMPVRDTRVLLERQQTIGALQDFTAGLQPVLRQVGDLERILARLALRTARPRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAIIDTPPVLVRDGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQISRGQSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLEALQQSASALAELDVLVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELESISPNAAATQVDGTQMSLLSVPEETSPAVEALENLDPDSLTPRQALEWIYRLKSLV vsr-mutl-2 B2H: bait = Vsr, prey= MutL 257048 N/A 257050 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 257051 unspecified role unspecified role prey prey physical association physical association false false false Interaction is greatly diminished in mutS strain muth-mutl-5 B2H: bait = MutH, prey= MutL 257048 N/A 257052 unspecified role unspecified role bait bait N/A 257051 unspecified role unspecified role prey prey physical association physical association false false false overexpression of Vsr Interaction is greatly diminished in mutS strain mutl-mutl-1 B2H: bait = MutL, prey= MutL 257048 N/A 257051 unspecified role unspecified role prey prey N/A 257051 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false overexpression of Vsr interaction inhibited in mutH strain muts-muts-1 B2H: bait = MutS, prey= MutS 257048 N/A 257053 unspecified role unspecified role prey prey N/A 257053 unspecified role unspecified role bait bait physical association physical association false false false interaction inhibited in mutH strain muth-mutl-6 B2H: bait = MutL, prey= MutH 257048 N/A 257052 unspecified role unspecified role prey prey N/A 257051 unspecified role unspecified role bait bait physical association physical association false false false overexpression of Vsr Interaction is greatly diminished in mutS strain muts-mutl-1 B2H: bait = MutS, prey= MutL 257048 N/A 257052 unspecified role unspecified role bait bait N/A 257051 unspecified role unspecified role prey prey physical association physical association false false false overexpression of Vsr interaction inhibited in mutH strain vsr-mutl-1 Y2H: bait = Vsr, prey= MutL 257049 N/A 257050 unspecified role unspecified role bait bait N/A 257051 unspecified role unspecified role prey prey physical association physical association false false false muth-mutl-1 Y2H: bait = MutH, prey= MutL 257049 N/A 257051 unspecified role unspecified role prey prey N/A 257052 unspecified role unspecified role bait bait physical association physical association false false false