IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fitzgerald-2001-1 Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fitzgerald KA., Palsson-McDermott EM., Bowie AG., Jefferies CA., Mansell AS., Brady G., Brint E., Dunne A., Gray P., Harte MT., McMurray D., Smith DE., Sims JE., Bird TA., O'Neill LA. Nature (0028-0836) 2001 fitzgerald-2001-2 Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fitzgerald KA., Palsson-McDermott EM., Bowie AG., Jefferies CA., Mansell AS., Brady G., Brint E., Dunne A., Gray P., Harte MT., McMurray D., Smith DE., Sims JE., Bird TA., O'Neill LA. Nature (0028-0836) 2001 tirap_human Toll/interleukin-1 receptor domain-containing adapter protein MyD88 adapter-like protein Adaptor protein Wyatt TIRAP MAL protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP p58753-2 Toll/interleukin-1 receptor domain-containing adapter protein TIRAP MAL Adaptor protein Wyatt MyD88 adapter-like protein protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRCKLLQEGEGERDSATVSDLL irak2_human Interleukin-1 receptor-associated kinase-like 2 IRAK2 protein protein human Homo sapiens Human MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQGQGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCPVNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRSPVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACLCLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDASSSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFGP tlr4_human Toll-like receptor 4 TLR4 hToll protein protein human Homo sapiens Human MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI tirap-myd88 Directed yeast-2-hybrid reveals interaction between the toll-interleukin 1 receptor domain-containing adapter protein and the Myeloid differentiation primary response protein (MyD88) 177301 N/A 177303 unspecified role unspecified role bait bait N/A 177304 unspecified role unspecified role prey prey physical association physical association false false false myd88-tirap Directed yeast-2-hybrid reveals interaction between the myeloid differentiation primary response protein (MyD88) and the toll-interleukin 1 receptor domain-containing adapter protein 177301 N/A 177303 unspecified role unspecified role prey prey N/A 177304 unspecified role unspecified role bait bait physical association physical association false false false myd88 Directed yeast-2-hybrid reveals that the myeloid differentiation primary response protein (MyD88) forms homotypic associations 177301 N/A 177304 unspecified role unspecified role prey prey N/A 177304 unspecified role unspecified role bait bait physical association physical association false false false MyD88 was shown to interact intra-molecularly using directed yeast-2-hybrid analysis and authors state, but do not demonstrate. that this interaction arises from homodimer formation. tirap Directed yeast-2-hybrid reveals that the toll-interleukin 1 receptor domain-containing adapter protein forms homotypic associations 177301 N/A 177305 unspecified role unspecified role prey prey N/A 177305 unspecified role unspecified role bait bait physical association physical association false false false Mal was shown to interact intra-molecularly using directed yeast-2-hybrid analysis and authors state, but do not demonstrate. that this interaction arises from homodimer formation. myd88-tirap-1 Coimmunoprecipitation reveals interaction between the myeloid differentiation primary response protein (MyD88) and the toll-interleukin 1 receptor domain-containing adapter protein 177302 N/A 177304 unspecified role unspecified role bait bait tir domain TIR domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region AU tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 177303 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tir domain TIR domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false tirap-irak2 Coimmunoprecipitation reveals interaction between the toll-interleukin 1 receptor domain-containing adapter protein and the Interleukin-1 receptor-associated kinase-like 2 177302 N/A 177303 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 177306 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false tirap-tlr4 Coimmunoprecipitation reveals interaction between the toll-interleukin 1 receptor domain-containing adapter protein and the Toll-like receptor 4 precursor 177302 N/A 177303 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 177307 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false