IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xia-2000-1 TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation. in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Xia XZ., Treanor J., Senaldi G., Khare SD., Boone T., Kelley M., Theill LE., Colombero A., Solovyev I., Lee F., McCabe S., Elliott R., Miner K., Hawkins N., Guo J., Stolina M., Yu G., Wang J., Delaney J., Meng SY., Boyle WJ., Hsu H. J. Exp. Med. (0022-1007) 2000 tn13b_human Tumor necrosis factor ligand superfamily member 13B TNF- and APOL-related leukocyte expressed ligand 1 B lymphocyte stimulator B-cell-activating factor Dendritic cell-derived TNF-like molecule UNQ401/PRO738 TNFSF13B BAFF BLYS TALL1 ZTNF4 TNFSF20 protein protein human Homo sapiens Human MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL tr13b_human Tumor necrosis factor receptor superfamily member 13B Transmembrane activator and CAML interactor TNFRSF13B TACI protein protein human Homo sapiens Human MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA tac1-tall_1 FACS analysis reveals interaction between the Tumor necrosis factor receptor superfamily member 13B (TAC1) and the Tumor necrosis factor ligand superfamily member 13B (TALL-1) 177791 N/A 177792 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false europium tag Europium tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 177793 unspecified role unspecified role bait bait human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false