MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint fujita-2000-1 Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fujita A., Nakamura K., Kato T., Watanabe N., Ishizaki T., Kimura K., Mizoguchi A., Narumiya S. J. Cell. Sci. (0021-9533) 2000 fujita-2000-2 Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fujita A., Nakamura K., Kato T., Watanabe N., Ishizaki T., Kimura K., Mizoguchi A., Narumiya S. J. Cell. Sci. (0021-9533) 2000 rhpn1_mouse Rhophilin-1 Rhpn1 Grbp GTP-Rho-binding protein 1 protein protein mouse Mus musculus Mouse MILEERPDGQGTGEESSRPQDDGSIRKGYGSFVQNQPGQLQSHRARLHQQISKELRMRTGAENLYRATSNTWVRETVALELSYVNSNLQLLKEELAELSTSVDVDQPEGEGITIPMIPLGLKETKELDWATPLKELISEHFGEDGTSFETEIQELEDLRQATRTPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHAPSPDMSAASLSMLEQLMIAQAQECIFKGLLLPASATPDICPDQLQLAQEAAQVATEYGLVHRAMAQPPVRDYLPASWTNLAHVKAEHFCALAHYHAAMALCESHPAKGELARQEHVFQPSTPHEPLGPTLPQHPEDRRKLAKAHLKRAILGQEEALRLHTLCRVLRKVDLLQVVVTQALRRSLAKYSQLEREDDFFEATEAPDIQPKTHQTPEGPLSVFSTKNRWQLVGPVHMTRGEGSFGFTLRGDSPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQLRSMGEEGVSLQVVSLLPSPEPRGTGPRRAALLWNQRECGFETPMPTRTRPWPILGWSRKNKQGKTGSHPDPCTNRNCVTCP mint Has no enzymatic activity. May serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules rop1_mouse Ropporin-1 Ropn1 Rhophilin-associated protein 1 Rhophilin-associated 'oppo' protein protein protein mouse Mus musculus Mouse MPQTDKQVCIPPELPELLKQFTKDAIRTQPPDLIQWAAEYFGAMSRGEIPPVRERSEQIPLSNWAELTPELLKVLHSRVAGRLIIHADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWLKFLALACSSLGVTIAKTLKIVCEVLSSDHDGGPPRIPFSTFQFLYTYIAEVDGEISSSHVSRMLNYIEQEVIGPDGLIKVNDFTQNPRVRLE mint rhpn1-ropn1 180360 rhpn1_mouse 180362 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 rop1_mouse 180363 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1C mint ropn1-ropn1 180360 rop1_mouse 180363 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 rop1_mouse 180363 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F4A F4B homomint mint rhpn1-ropn1-1 180360 rhpn1_mouse 180362 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 rop1_mouse 180363 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 physical association physical association false false false F5 mint rhpn1-ropn1-2 180361 rhpn1_mouse 180362 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 rop1_mouse 180363 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F3A mint