MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint chang-1999a-2 Direct binding and In vivo regulation of the fission yeast p21-activated kinase shk1 by the SH3 domain protein scd2. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chang E., Bartholomeusz G., Pimental R., Chen J., Lai H., Wang L., Yang P., Marcus S. Figure 2 smarcus@notes.mdacc.tmc.edu Mol. Cell. Biol. (0270-7306) 1999 chang-1999a-1 Direct binding and In vivo regulation of the fission yeast p21-activated kinase shk1 by the SH3 domain protein scd2. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Chang E., Bartholomeusz G., Pimental R., Chen J., Lai H., Wang L., Yang P., Marcus S. Figure 2 smarcus@notes.mdacc.tmc.edu Mol. Cell. Biol. (0270-7306) 1999 chang-1999a-3 Direct binding and In vivo regulation of the fission yeast p21-activated kinase shk1 by the SH3 domain protein scd2. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Chang E., Bartholomeusz G., Pimental R., Chen J., Lai H., Wang L., Yang P., Marcus S. Figure 2 smarcus@notes.mdacc.tmc.edu Mol. Cell. Biol. (0270-7306) 1999 ste20_schpo Serine/threonine-protein kinase shk1/pak1 shk1 orb2 pak1 SPBC1604.14c ste20 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MERGTLQPRKKAPNGYGITPIVAHKTGEPVRYEVEDDLRKLKPSRTAPKPPAINTNLAEDTFSGFPLSQSRTTVSRVSLGSRQHSSSSIRKLQTNVSDVRSYDERNQKKSAFENFVSSMSSFLTGGGSSPTSSYGSGSASPRKSTVISSPFDPKHVTHVGFNYDTGEFTGMPTEWQALLKVSGITKSEQVQHPQAVLDAMAFYSQSKKYLEEGAKPPFPRESTEKPLLSVSALSSSSHLQPTSATSSSSRLYPSRPAPTPPASSSSSPLLSSQTVKTTTSNASRQPSPLVSSKSTDNIIRSHSPVLLTPQTLSTSETKHIRPNNSTPYQRRAETSTKPKAVATPQKVEAPSAPRLQKRAPRQQSNDSAVLAKLQSICNPKNPTLLYRNFVKIGQGASGDVYSARQVGTNLSVAIKKMNINQQPKKEFIVNEILVMKSHHHKNIVNFIDTFFYKSELWMVMEYMRGGSLTEVVTNNTLSEGQIAAICKETLEGLQHLHENGIVHRDIKSDNILLSLQGDIKLTDFGFCAQIDSNMTKRTTMVGTPYWMAPEVVTRKEYGFKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATIGTPKISRPELLSSVFHDFLSKSLTVNPKQRPSSGELLRHPFLKQAVPVSSLIPLIKSIHHSGK scd2_schpo Protein scd2/ral3 ral3 SPAC22H10.07 scd2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLKIKRTWKTHSRILDKDPFSIEPPRKVIRALYDYTARKATEVSFAKGDFFHVIGRENDKAWYEVCNPAAGTRGFVPVSHFEEIGKTVKSERDSDGSGQISFTDLTTNSSTTRSSISELHSGSQPLFGIVQFDFAAERPDELEAKAGEAIIIIARSNHEWLVAKPIGRLGGPGLIPLSFIQLRDLKTGAVIKDVSEAVLRISCIPRVEDWKRAAADYKKSSIPLGKFSDGETQTMPSLSPSTENLQINNDVTYQAATDNSSTFPGSVANELTPLQTLESRTASIASKNKKDMSSEPTVVAAMVENYMIRDDQYWYLVRAVMSDGKHRNLCRYYEDFFNFQTKFLELFPNEAGRGDERRVIPYMPGPVDDVNELISSQRAMDLDVYLKEMCRLPARLLENELVKLFFLPLDGDVESPHPTSTMPEALPREPLSFSLPEKAPEKATNISIPESAPTTAGSTCKVKVRLGDETFALRVPSDISFEDFCERLTNKLGECEHLSYRDTNANKVLPLNNVDDLRKACSQESGVLLFAERRRF cdc42_schpo Cell division control protein 42 homolog CDC42Sp cdc42 SPAC110.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPTIKCVVVGDGAVGKTCLLISYTTNKFPSDYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLRDDPSVQQKLARQHQHPLTHEQGERLARELGAVKYVECSALTQKGLKNVFDEAIVAALDPPVPHKKKSKCLVL scd2-shk1-1 Directed yeast two hybrid reveals interaction between the Scd2 protein and Shk1 a protein 258439 N/A 258442 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 258443 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false shk1-cdc42 Directed yeast two hybrid reveals interaction between the Shk1 protein and Cdc42 protein 258439 N/A 258444 unspecified role unspecified role prey prey N/A 258442 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false Scd2 (P40996) stimulated binding of Shk1 and Cdc42. shk1-scd2-1 Far western analysis reveals interaction between the Shk1 a protein Scd2 protein 258440 N/A 258442 unspecified role unspecified role bait bait 6his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 258443 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false shk1-scd2 Protein kinase assay demonstrates Shk1 phosphorylates Scd2 in vitro 258441 N/A 258443 enzyme target enzyme target substrate substrate unspecified role unspecified role 6his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 258442 enzyme enzyme unspecified role unspecified role 6his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation false false false