IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ choi-1999a-2 Phytochrome signalling is mediated through nucleoside diphosphate kinase 2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Choi G., Yi H., Lee J., Kwon YK., Soh MS., Shin B., Luka Z., Hahn TR., Song PS. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Directed yeast two hybrid assay. Figure 1 (a, (c) and (d). gtcoi@ksc.kumho.co.kr A cDNA library from 1 week old light grown arabidopsis seedlings (ecotype Columbia) was used in this yeast two hybrid assay. Nature (0028-0836) 1999 choi-1999a-1 Phytochrome signalling is mediated through nucleoside diphosphate kinase 2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Choi G., Yi H., Lee J., Kwon YK., Soh MS., Shin B., Luka Z., Hahn TR., Song PS. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. gtcoi@ksc.kumho.co.kr A cDNA library from 1 week old light grown arabidopsis seedlings (ecotype Columbia) was used in this yeast two hybrid assay. Nature (0028-0836) 1999 ndk2_arath Nucleoside diphosphate kinase II, chloroplastic NDPK2 At5g63310 MDC12.28 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVGATVVSKWTPLCVASPPERNSASLNPHCSPARVNFRTALAAFRPQFRLFSRNSASRRRLRASSSAESGIFLPHLVASMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE phya_arath Phytochrome A PHYA HY8 At1g09570 F14J9.23 FHY2 FRE1 Protein FAR RED ELONGATED HYPOCOTYL 2 Protein FAR RED ELONGATED 1 Protein ELONGATED HYPOCOTYL 8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGSRPTQSSEGSRRSRHSARIIAQTTVDAKLHADFEESGSSFDYSTSVRVTGPVVENQPPRSDKVTTTYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENASELLTMASHAVPSVGEHPVLGIGTDIRSLFTAPSASALQKALGFGDVSLLNPILVHCRTSAKPFYAIIHRVTGSIIIDFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMVQEVFELTGYDRVMAYKFHEDDHGEVVSEVTKPGLEPYLGLHYPATDIPQAARFLFMKNKVRMIVDCNAKHARVLQDEKLSFDLTLCGSTLRAPHSCHLQYMANMDSIASLVMAVVVNEEDGEGDAPDATTQPQKRKRLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVNKEVELDNQMVEKNILRTQTLLCDMLMRDAPLGIVSQSPNIMDLVKCDGAALLYKDKIWKLGTTPSEFHLQEIASWLCEYHMDSTGLSTDSLHDAGFPRALSLGDSVCGMAAVRISSKDMIFWFRSHTAGEVRWGGAKHDPDDRDDARRMHPRSSFKAFLEVVKTRSLPWKDYEMDAIHSLQLILRNAFKDSETTDVNTKVIYSKLNDLKIDGIQELEAVTSEMVRLIETATVPILAVDSDGLVNGWNTKIAELTGLSVDEAIGKHFLTLVEDSSVEIVKRMLENALEGTEEQNVQFEIKTHLSRADAGPISLVVNACASRDLHENVVGVCFVAHDLTGQKTVMDKFTRIEGDYKAIIQNPNPLIPPIFGTDEFGWCTEWNPAMSKLTGLKREEVIDKMLLGEVFGTQKSCCRLKNQEAFVNLGIVLNNAVTSQDPEKVSFAFFTRGGKYVECLLCVSKKLDREGVVTGVFCFLQLASHELQQALHVQRLAERTAVKRLKALAYIKRQIRNPLSGIMFTRKMIEGTELGPEQRRILQTSALCQKQLSKILDDSDLESIIEGCLDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVMSDTLYGDSIRLQQVLADFMLMAVNFTPSGGQLTVSASLRKDQLGRSVHLANLEIRLTHTGAGIPEFLLNQMFGTEEDVSEEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIITAELAAANK phya-ndpk2-1 Yeast 2 hybrid analysis reveals interaction between the PHYA photoreceptor protein and the NDPK2 protein 204798 N/A 204800 unspecified role unspecified role prey prey N/A 204801 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false phya-ndpk2-2 Yeast 2 hybrid analysis reveals interaction between the PHYA photoreceptor protein and the NDPK2 protein 204798 N/A 204801 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P14712:p.Gly727Glu Glycine to glutamine at position 788 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P14712:p.Gly750Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 204800 unspecified role unspecified role prey prey physical association physical association false false false phya-ndpk2 Yeast 2 hybrid analysis reveals interaction between the PHYA photoreceptor protein and the NDPK2 protein 204799 N/A 204800 unspecified role unspecified role prey prey N/A 204801 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false