IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ moon-1999-2 Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Moon YH., Kang HG., Jung JY., Jeon JS., Sung SK., An G. Directed yeast two hybrid assay used in this experiment. Table 1. genean@postech.ac.kr A cDNA library of rice panicles was used in this study. Plant Physiol. (0032-0889) 1999 moon-1999-1 Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Moon YH., Kang HG., Jung JY., Jeon JS., Sung SK., An G. Table 1. genean@postech.ac.kr A cDNA library of rice panicles was used in this study. Plant Physiol. (0032-0889) 1999 mads6_orysj MADS-box transcription factor 6 MADS6 MFO1 OsMADS6 Protein MOSAIC FLORAL ORGANS 1 OJ1123_G04.6 OsJ_07942 Os02g0682200 LOC_Os02g45770 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGITKTLERYQHCCYNAQDSNNALSETQSWYHEMSKLKAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLGEINRQLKHKLEVEGSTSNYRAMQQASWAQGAVVENGAAYVQPPPHSAAMDSEPTLQIGYPHQFVPAEANTIQRSTAPAGAENNFMLGWVL mads1_orysj MADS-box transcription factor 1 MADS1 LHS1 OsMADS1 Protein LEAFY HULL STERILE 1 Protein SEPALLATA-like OsJ_09913 LOC_Os03g11614 Os03g0215400 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSSSSCMYKTLERYRSCNYNSQDAAAPENEINYQEYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLENQIEVSLKQIRSRKNQALLDQLFDLKSKEQQLQDLNKDLRKKLQETSAENVLHMSWQDGGGHSGSSTVLADQPHHHQGLLHPHPDQGDHSLQIGYHHPHAHHHQAYMDHLSNEAADMVAHHPNEHIPSGWI mads5_orysj MADS-box transcription factor 5 MADS5 FDRMADS2 OsMADS5 OsJ_019405 P0681F10.39 LOC_Os06g06750 Os06g0162800 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFSTSSCMYKTLERYRSCNYNLNSCEASAALETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLVPLSLKELEQLENQIEISLMNIRSSKNQQLLDQVFELKRKEQQLQDANKDLKRKIQETSGENMLHISCQDVGPSGHASEANQEFLHHAICDPSLHIGYQAYMDHLNQ mads7_orysj MADS-box transcription factor 7 MADS7 AGL6 FDRMADS1 M79 MADS-box protein 45 MADS45 OsMADS45 OsMADS7 Protein AGAMOUS-like 6 RMADS216 P0702E04.10 LOC_Os08g41950 Os08g0531700 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGYPAEHHEAMNSACMNTYMPPWLP mads8_orysj MADS-box transcription factor 8 MADS8 OsMADS8 MADS-box protein 24 OsMADS24 MADS24 OsJ_29947 LOC_Os09g32948 Os09g0507200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGQSMTRTLERYQKFSYGGPDTAIQNKENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGTLGIKELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKLEESNQLHGQVWEHGATLLGYERQSPHAVQQVPPHGGNGFFHSLEAAAEPTLQIGFTPEQMNNSCVTAFMPTWLP mad14_orysj MADS-box transcription factor 14 MADS14 AGL10 FDRMADS6 OsMADS14 Protein AGAMOUS-like 10 Protein APETALA1-like B RAP1B RMADS211 OJ1112_G08.13 OSJNBa0032E21.04 OSJNBa0047E24.2 OsJ_12598 LOC_Os03g54160 Os03g0752800 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYEYATDSCMDKILERYERYSYAEKVLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKELVEKQKVQKQQVQWDQTQPQTSSSSSSFMMREALPTTNISNYPAAAGERIEDVAAGQPQHVRIGLPPWMLSHING mad15_orysj MADS-box transcription factor 15 MADS15 RAP1A FDRMADS3 OsMADS15 Protein APETALA1-like A RMADS215 OJ1567_G09.109-1 P0585H11.124-1 Os07g0108900 LOC_Os07g01820 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYATDSRMDKILERYERYSYAEKALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQKELVERQKNVRGQQQVGQWDQTQVQAQAQAQPQAQTSSSSSSMLRDQQALLPPQNICYPPVMMGERNDAAAAAAVAAQGQVQLRIGGLPPWMLSHLNA mad17_orysj MADS-box transcription factor 17 MADS17 NMADS3 OsMADS17 RMADS213 OSJNBa0064M23.11 Os04g0580700 LOC_Os04g49150 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGINKTLEKYNSCCYNAQGSNSALAGGEHQSWYQEMSRLKTKLECLQRSQRHMLGEDLGPLSIKELQQLEKQLEYSLSQARQRKTQIMMEQVDDLRRKERQLGELNKQLKNKLEAEADSSNCRSAIQDSWVHGTVVSGGRVLNAQPPPDIDCEPTLQIGYYQFVRPEAANPRSNGGGGDQNNNFVMGWPL mad18_orysj MADS-box transcription factor 18 MADS18 MADS2 MADS28 FDRMADS7 MADS-box protein 2 MADS-box protein 28 OsMADS18 OsMADS2 OsMADS28 OSJNBb0040H10.26 OsJ_25046 LOC_Os07g41370 Os07g0605200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSSHSSMEGILERYQRYSFDERAVLEPNTEDQENWGDEYGILKSKLDALQKSQRQLLGEQLDTLTIKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLMETEKEKNNAIINTNREEQNGATPSTSSPTPVTAPDPIPTTNNSQSQPRGSGESEAQPSPAQAGNSKLPPWMLRTSHT osmads6-mads1-1 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and MADS1 protein 207925 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207928 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads6-osmads5-1 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS5 protein 207925 N/A 207929 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads6-osmads7-1 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS7 protein 207925 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 207930 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads6-osmads8 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS8 protein 207925 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207931 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads6-osmads14-1 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS14 protein 207925 n/a 207932 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q6EU39:p.[Leu110Arg;Leu118Arg;Leu159Arg;Leu166Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q6EU39:p.[Leu110Ser;Leu118Arg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q6EU39:p.[Leu126Arg;Leu134Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q6EU39:p.[Leu159Arg;Leu166Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads6-osmads15-1 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS15 protein 207925 N/A 207933 unspecified role unspecified role prey prey N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false MADS15 construct contains K domain and C region of the protein, range not given in text. osmads6-osmads17-1 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS17 protein 207925 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207934 unspecified role unspecified role prey prey physical association physical association false false false The OSMADS17 protein contained the K domain and C region of the protein, range not given in text. osmads6-osmads18-1 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS18 protein 207925 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207935 unspecified role unspecified role prey prey physical association physical association false false false The OSMADS18 protein contained the K domain and C terminal region, range not given in text. osmads14-osmads6 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS14 protein and OSMADS6 protein 207925 n/a 207932 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207927 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q6EU39:p.[Leu110Arg;Leu118Arg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q6EU39:p.[Leu126Arg;Leu134Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q6EU39:p.[Leu159Arg;Leu166Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q6EU39:p.[Leu110Arg;Leu118Arg;Leu159Arg;Leu166Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mads1-osmads6 Yeast 2 hybrid analysis reveals interaction between MADS1 protein and the OSMADS6 protein 207926 N/A 207927 unspecified role unspecified role prey prey N/A 207928 unspecified role unspecified role bait bait physical association physical association false false false osmads6-osmads5 Yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS5 protein 207926 N/A 207929 unspecified role unspecified role prey prey N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads6-mads1 Yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and MADS1 protein 207926 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207928 unspecified role unspecified role prey prey physical association physical association false false false osmads6-osmads7 Yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS7 protein 207926 n/a 207930 unspecified role unspecified role prey prey N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads6-osmads14 Yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS14 protein 207926 n/a 207932 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads6-osmads15 Yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS15 protein 207926 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207933 unspecified role unspecified role prey prey physical association physical association false false false osmads6-osmads17 Yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS17 protein 207926 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207934 unspecified role unspecified role prey prey physical association physical association false false false osmads6-osmads18 Yeast 2 hybrid analysis reveals interaction between the OSMADS6 protein and OSMADS18 protein 207926 N/A 207927 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207935 unspecified role unspecified role prey prey physical association physical association false false false