IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ daviet-1999-1 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 daviet-1999-2 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 daviet-1999-3 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 daviet-1999-4 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging sequence tag sequence tag identification sequence tag Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 daviet-1999-5 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 agtra_mouse Type-1A angiotensin II receptor Angiotensin II type-1A receptor Agtr1a Agtr1 protein protein mouse Mus musculus Mouse MALNSSTEDGIKRIQDDCPRAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVCAFHYESRNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCKIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNMSSAAKKPASCSEVE atrap_mouse Type-1 angiotensin II receptor-associated protein AT1 receptor-associated protein Agtrap Atrap protein protein mouse Mus musculus Mouse MELPAVNLKVILLVHWLLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLGGLVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLRPDFFGPSQEHSAYQTIDSSSDAAADPFASLENKGQAVPRGY agtr1-agtrap-1 Interaction of AT-1A receptor with ATRAP detected by yeast two hybrid. 257081 N/A 257086 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 257087 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false agtr1-agtrap-2 Interaction of At-1A receptor and ATRAP detected by pull down. 257082 N/A 257087 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 257086 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminus binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false agtr1-agtrap-3 Interaction of AT-1A and ATRAP detected by anti-tap co-immunoprecipitation. 257083 N/A 257087 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 257086 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association false false false No significant difference was observed in the amount of ATRAP co-immunoprecipitated with the AT1 receptor before or after Ang II stimulation. agtr1-agtrap-4 Interaction of AT-1A and ATRAP detected by co-immunolocalization. 257084 N/A 257086 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 257087 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 colocalization colocalization false false false agtr1-agtrap-5 Interaction of ATRAP with the C-terminal portion of AT-1A detected by yeast two hybrid. 257085 N/A 257086 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 257087 unspecified role unspecified role prey prey physical association physical association false false false The levels of beta-galactosidase expression were qualified. Interactions with AT-1A(297-359AA) and ATRAP produced a beta-gal measurement of 160 beta-gal units, whereas, AT-1A (297-349AA) produced a beta-gal measurement of 60 beta gal units. AT-1A which was truncated to 297-339AA or less (297-329AA) did not interact with ATRAP.