MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint hung-1998-1 Structure of an enantiomeric protein, D-monellin at 1.8 A resolution. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hung LW., Kohmura M., Ariyoshi Y., Kim SH. Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 1998 monb_diocu Monellin chain B Monellin chain II protein protein serendipity berry Dioscoreophyllum cumminsii GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEEN Taste-modifying protein; intensely sweet-tasting protein mint mona_diocu Monellin chain A Monellin chain I protein protein serendipity berry Dioscoreophyllum cumminsii FREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP mint Taste-modifying protein; intensely sweet-tasting protein mona-monb 101412 monb_diocu 101413 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 mona_diocu 101414 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false In the xray complex 1n98, P02881 is chain A and P02882 is chain B Resolution 1.800 mint