IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rudolph-1998-1 The Cdc42/Rac interactive binding region motif of the Wiskott Aldrich syndrome protein (WASP) is necessary but not sufficient for tight binding to Cdc42 and structure formation. in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Rudolph MG., Bayer P., Abo A., Kuhlmann J., Vetter IR., Wittinghofer A. J. Biol. Chem. (0021-9258) 1998 rudolph-1998-2 The Cdc42/Rac interactive binding region motif of the Wiskott Aldrich syndrome protein (WASP) is necessary but not sufficient for tight binding to Cdc42 and structure formation. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Rudolph MG., Bayer P., Abo A., Kuhlmann J., Vetter IR., Wittinghofer A. J. Biol. Chem. (0021-9258) 1998 rudolph-1998-3 The Cdc42/Rac interactive binding region motif of the Wiskott Aldrich syndrome protein (WASP) is necessary but not sufficient for tight binding to Cdc42 and structure formation. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Rudolph MG., Bayer P., Abo A., Kuhlmann J., Vetter IR., Wittinghofer A. J. Biol. Chem. (0021-9258) 1998 rudolph-1998-4 The Cdc42/Rac interactive binding region motif of the Wiskott Aldrich syndrome protein (WASP) is necessary but not sufficient for tight binding to Cdc42 and structure formation. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Rudolph MG., Bayer P., Abo A., Kuhlmann J., Vetter IR., Wittinghofer A. J. Biol. Chem. (0021-9258) 1998 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL wasp_human Wiskott-Aldrich syndrome protein WAS IMD2 protein protein human Homo sapiens Human MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD cdc42-was-1 fluorescence titration : human cdc42 and human WASP 164836 N/A 164840 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 164841 unspecified role unspecified role neutral component neutral component crib binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false GTP-loading on cdc42 is necessary for binding cdc42-was-3 circular dichroism : human cdc42 and human WASP 164836 N/A 164840 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 164841 unspecified role unspecified role neutral component neutral component crib binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false cdc42-was-2 surface plasma resonance : human cdc42 and human WASP 164837 N/A 164841 unspecified role unspecified role bait bait crib binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 164840 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false cdc42-was-5 circular dichroism : human cdc42 and human WASP 164838 N/A 164840 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 164841 unspecified role unspecified role neutral component neutral component crib binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false cdc42-was-4 RMN : human cdc42 and human WASP 164839 N/A 164840 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 164841 unspecified role unspecified role neutral component neutral component crib binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false