MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint duda-2004-1 S100B-modulated Ca2+-dependent ROS-GC1 transduction machinery in the gustatory epithelium: a new mechanism in gustatory transduction. bovin Bos taurus (Bovine) Bovine coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Duda T., Sharma RK. dudatm@umdnj.edu FEBS Lett. (0014-5793) 2004 guc1a_bovin Guanylyl cyclase-activating protein 1 GUCA1A GCAP1 GUCA1 Guanylate cyclase activator 1A protein protein bovin Bos taurus (Bovine) Bovine MGNIMDGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPWASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRAINPCSDSTMTAEEFTDTVFSKIDVNGDGELSLEEFMEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGASGRETEAAEADG mint Stimulates guanylyl cyclase 1 (GC1) when free calcium ions concentration is low and inhibits GC1 when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure s100b_bovin Protein S100-B S100B S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein bovin Bos taurus (Bovine) Bovine MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE guca1a-s100b 166657 guc1a_bovin 166658 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 s100b_bovin 166659 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false F4 homomint mint