MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint shao-2004-1 Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. For the second round of immunoblotting, the blot was stripped and reprobed. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation shao-2004-2 Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. For the second round of immunoblotting, the blot was stripped and reprobed. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation shao-2004-3 Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] imaging technique imaging technique microscopy immunostaining immunostaining Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. For the second round of immunoblotting, the blot was stripped and reprobed. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation shao-2004-4 Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. mouse-brain Mus musculus brain brain Brain [cerebrum] imaging technique imaging technique microscopy immunostaining immunostaining Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. For the second round of immunoblotting, the blot was stripped and reprobed. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation sumo1_mouse Small ubiquitin-related modifier 1 Sumo1 Smt3c Smt3h3 Ubl1 Ubiquitin-like protein SMT3C SMT3 homolog 3 Ubiquitin-homology domain protein PIC1 protein protein mouse Mus musculus Mouse MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV hif1a_mouse Hypoxia-inducible factor 1-alpha Hif1a ARNT-interacting protein protein protein mouse Mus musculus Mouse MEGAGGENEKKKMSSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGGLDSEDEMKAQMDCFYLKALDGFVMVLTDDGDMVYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVRKGKELNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTESVLKPVESSDMKMTQLFTKVESEDTSCLFDKLKKEPDALTLLAPAAGDTIISLDFGSDDTETEDQQLEDVPLYNDVMFPSSNEKLNINLAMSPLPSSETPKPLRSSADPALNQEVALKLESSPESLGLSFTMPQIQDQPASPSDGSTRQSSPERLLQENVNTPNFSQPNSPSEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTVTGFQQTQLQKPTITATATTTATTDESKTETKDNKEDIKILIASPSSTQVPQETTTAKASAYSGTHSRTASPDRAGKRVIEQTDKAHPRSLNLSATLNQRNTVPEEELNPKTIASQNAQRKRKMEHDGSLFQAAGIGTLLQQPGDCAPTMSLSWKRVKGFISSEQNGTEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN hif1a-sumo1-1 Interaction detected by co-immunoprecipitation 168162 N/A 168166 unspecified role unspecified role prey prey N/A 168167 unspecified role unspecified role bait bait physical association physical association false false false Interaction occurs in response to hypoxic stimulation. hif1a-sumo1-2 Interaction detected by co-immunoprecipitation 168162 N/A 168166 unspecified role unspecified role bait bait N/A 168167 unspecified role unspecified role prey prey physical association physical association false false false Interaction occurs in response to hypoxic stimulation. hif1a-sumo1-3 Interaction detected by co-immunoprecipitation 168163 N/A 168167 unspecified role unspecified role bait bait N/A 168166 unspecified role unspecified role prey prey physical association physical association false false false Interaction occurs in response to hypoxic stimulation. hif1a-sumo1-4 Interaction detected by co-immunoprecipitation 168163 N/A 168167 unspecified role unspecified role prey prey N/A 168166 unspecified role unspecified role bait bait physical association physical association false false false Interaction occurs in response to hypoxic stimulation. hif1a-sumo1-5 Interaction detected by co-localisation 168164 N/A 168166 unspecified role unspecified role neutral component neutral component N/A 168167 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false hif1a-sumo1-6 Interaction detected by co-localisation 168165 N/A 168166 unspecified role unspecified role neutral component neutral component N/A 168167 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false