IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ye-2004-4 A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Ye Y., Shibata Y., Yun C., Ron D., Rapoport TA. HeLa cell membrane extract was used in the experiment. Nature (0028-0836) 2004 p97 construct described in PMID:15215856,referenced in this paper ye-2004-3 A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Ye Y., Shibata Y., Yun C., Ron D., Rapoport TA. HeLa cell membrane extract was used in the experiment. Nature (0028-0836) 2004 p97 construct described in PMID:15215856,referenced in this paper ye-2004-1 A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ye Y., Shibata Y., Yun C., Ron D., Rapoport TA. HeLa cell membrane extract was used in the experiment. Nature (0028-0836) 2004 p97 construct described in PMID:15215856,referenced in this paper ye-2004-2 A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Ye Y., Shibata Y., Yun C., Ron D., Rapoport TA. HeLa cell membrane extract was used in the experiment. Nature (0028-0836) 2004 p97 construct described in PMID:15215856,referenced in this paper sels_human Selenoprotein S SELENOS SELS VCP-interacting membrane protein VIMP AD-015 SBBI8 protein protein human Homo sapiens Human MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG tera_mouse Transitional endoplasmic reticulum ATPase Vcp 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein mouse Mus musculus Mouse MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG derl1_human Derlin-1 DERL1 UNQ243/PRO276 Der1-like protein 1 Degradation in endoplasmic reticulum protein 1 DER1 protein protein human Homo sapiens Human MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ us11_hcmva Unique short US11 glycoprotein US11 gpUS11 Protein HXLF1 protein protein hcmva Human cytomegalovirus (strain AD169) (HHV-5) Human herpesvirus 5 HHV-5 MNLVMLILALWAPVAGSMPELSLTLFDEPPPLVETEPLPPLSDVSEYRVEYSEARCVLRSGGRLEALWTLRGNLSVPTPTPRVYYQTLEGYADRVPTPVEDVSESLVAKRYWLRDYRVPQRTKLVLFYFSPCHQCQTYYVECEPRCLVPWVPLWSSLEDIERLLFEDRRLMAYYALTIKSAQYTLMMVAVIQVFWGLYVKGWLHRHFPWMFSDQW ufd1_rat Ubiquitin recognition factor in ER-associated degradation protein 1 Ufd1 Ubiquitin fusion degradation protein 1 homolog Ufd1l protein protein rat Rattus norvegicus (Rat) Rat MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPMVKKVEEDEAGGRFVAFSGEGQSLRKKGRKP tera_rat Transitional endoplasmic reticulum ATPase Vcp 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein rat Rattus norvegicus (Rat) Rat MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGNVYTEDNDDDLYG vcp-sels-3 VCP co-localises with SELS in COS cells. 142216 N/A 142220 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 142221 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false vcp-der1-sels-2 VCP co-localises with DER1 and SELS in COS cells. 142216 N/A 142221 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 142220 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 142222 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false der1-us11 DER1 co-localises with US11 in COS cells. 142216 N/A 142223 unspecified role unspecified role neutral component neutral component N/A 142222 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Visualised in COS cells using HA and US11 antibodies. vcp-sels-2 Interaction between VCP and SELS detected by GST pull down. 142217 N/A 142220 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 142221 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false SELS was GST-tagged. The cytosolic domain (aa49-187) of SELS is sufficient for its interaction with VCP. vcp-sels-q9es53 Interaction between SELS, VCP and Q9ES53 (UFD1) detected by GST pull down. 142217 N/A 142224 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver N/A 142220 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 142225 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association false false false SELS was GST-tagged. The cytosolic domain (aa49-187) of SELS is sufficient for its interaction with VCP and Q9ES53 (UFD1). vcp-der1-sels-1 Interaction between VCP, DER1 and SELS detected by CoIP. 142218 N/A 142220 unspecified role unspecified role bait bait N/A 142221 unspecified role unspecified role prey prey N/A 142222 unspecified role unspecified role prey prey association association false false false vcp-sels-1 Interaction between VCP and SELS detected by CoIP. 142219 N/A 142221 unspecified role unspecified role prey prey N/A 142220 unspecified role unspecified role bait bait physical association physical association false false false SELS was Myc tagged and P97 was His tagged. Coexpressed in HEK293 cells.