IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ berti-2004-2 Mig12, a novel Opitz syndrome gene product partner, is expressed in the embryonic ventral midline and co-operates with Mid1 to bundle and stabilize microtubules. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Berti C., Fontanella B., Ferrentino R., Meroni G. Interaction-mating yeast-two hybrid assay was used. berti.caterina@hsr.it BMC Cell Biol. 2004 berti-2004-5 Mig12, a novel Opitz syndrome gene product partner, is expressed in the embryonic ventral midline and co-operates with Mid1 to bundle and stabilize microtubules. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Berti C., Fontanella B., Ferrentino R., Meroni G. berti.caterina@hsr.it BMC Cell Biol. 2004 berti-2004-1 Mig12, a novel Opitz syndrome gene product partner, is expressed in the embryonic ventral midline and co-operates with Mid1 to bundle and stabilize microtubules. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Berti C., Fontanella B., Ferrentino R., Meroni G. berti.caterina@hsr.it BMC Cell Biol. 2004 berti-2004-3 Mig12, a novel Opitz syndrome gene product partner, is expressed in the embryonic ventral midline and co-operates with Mid1 to bundle and stabilize microtubules. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Berti C., Fontanella B., Ferrentino R., Meroni G. berti.caterina@hsr.it BMC Cell Biol. 2004 berti-2004-4 Mig12, a novel Opitz syndrome gene product partner, is expressed in the embryonic ventral midline and co-operates with Mid1 to bundle and stabilize microtubules. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Berti C., Fontanella B., Ferrentino R., Meroni G. berti.caterina@hsr.it BMC Cell Biol. 2004 berti-2004-6 Mig12, a novel Opitz syndrome gene product partner, is expressed in the embryonic ventral midline and co-operates with Mid1 to bundle and stabilize microtubules. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Berti C., Fontanella B., Ferrentino R., Meroni G. berti.caterina@hsr.it BMC Cell Biol. 2004 m1ip1_mouse Mid1-interacting protein 1 Mid1ip1 Mig12 Gastrulation-specific G12-like protein Mid1-interacting G12-like protein Protein STRAIT11499 homolog Spot 14-related protein protein protein mouse Mus musculus Mouse MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLSEPEIDEVSVEVGGSGGCLEERTTPAPSPGSANESFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPSSPPAGSEESTWKPKDILVGLSHLESADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFSNWGH tri18_mouse E3 ubiquitin-protein ligase Midline-1 RING-type E3 ubiquitin transferase Midline-1 Mid1 Fxy Trim18 Tripartite motif-containing protein 18 Midin RING finger protein Midline-1 protein protein mouse Mus musculus Mouse METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNEPVESINAFQCPTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMSSAEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETLLAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVIRLRKLAQQIANCKQCLERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFDTFALDFSREKKLLECLDYLTAPNPPAIREELCTASYDTITVHWTSEDEFSVVSYELQYTIFTGQANVVNVACDGTCLLGSAGLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFTVKAINQAGSRSSEPGKLKTNSQPFRLDPKSAHRKLKVSHDNLTVERDESSSKKSHAPERFAGQGSYGVAGNVFIDSGRHYWEVVTSGSTWYAIGLAYRSAPKHEWIGKNAASWALCRCHNHWAVRHDGKETPIAPAPHLRRVGVLLDYDNGSIAFYDALSSVHLHTFHAALAQPVCPTFTVWNKCLTIVTGLPIPDHLDCTEQRP mid1-mid1ip1-1 Interaction detected by Y2H 168186 N/A 168192 unspecified role unspecified role prey prey N/A 168193 unspecified role unspecified role bait bait coiled-coil binding region binding-associated region binding region range range range range false physical association physical association false false false mid1-mid1ip1-3 Interaction detected by Y2H 168186 N/A 168192 unspecified role unspecified role prey prey N/A 168193 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false mid1-mid1ip1-6 Interaction detected by co-immunoprecipitation 168187 N/A 168193 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false coiled-coil binding region binding-associated region binding region range range range range false N/A 168192 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mid1-mid1ip1-7 Interaction detected by co-immunoprecipitation 168187 N/A 168192 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 168193 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false coiled-coil binding region binding-associated region binding region range range range range false physical association physical association false false false mid1-mid1ip1-2 Interaction detected by Y2H 168188 N/A 168192 unspecified role unspecified role prey prey N/A 168193 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false mid1-mid1ip1-4 Interaction detected by co-immunoprecipitation 168189 N/A 168192 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 168193 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mid1-mid1ip1-5 Interaction detected by co-immunoprecipitation 168190 N/A 168193 unspecified role unspecified role bait bait gfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 168192 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mid1-mid1ip1-8 Colocalisation detected by immunofluorescence 168191 N/A 168192 unspecified role unspecified role neutral component neutral component N/A 168193 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false