IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ luo-2004-2 The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Luo L., Yang X., Takihara Y., Knoetgen H., Kessel M. Chromatin - Epigenetic interactions resulting in chromatin modulation 8.5 dpc mouse cDNA library used for screening. Nature (0028-0836) 2004 luo-2004-1 The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Luo L., Yang X., Takihara Y., Knoetgen H., Kessel M. Chromatin - Epigenetic interactions resulting in chromatin modulation 8.5 dpc mouse cDNA library used for screening. Nature (0028-0836) 2004 hxd10_mouse Homeobox protein Hox-D10 Homeobox protein Hox-4.5 Hoxd10 Hox-4.5 Hoxd-10 Homeobox protein Hox-5.3 protein protein mouse Mus musculus Mouse MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTANIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNESASGQEPTKVSQVESPEAKGGLPEDRSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS gemi_mouse Geminin Gmnn protein protein mouse Mus musculus Mouse MNLSMKQKQEGAQENVKNSPVPRRTLKMIQPSADGSLVGRENELPKGLFKRKLWDDQLASQTSSCGPEANENKDVGDLTQEAFDLISKENPSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIERLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTCAEETVSSSTDARPCT hxa11_mouse Homeobox protein Hox-A11 Hoxa11 Hox-1.9 Hoxa-11 Homeobox protein Hox-1.9 protein protein mouse Mus musculus Mouse MMDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKNAEKGPQAAAATSAAAVAAAATGAPATSSSDGGGGGGCQEAAAEEKERRRRPESSSSPESSSGHTEDKAGGSGGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL scmh1_mouse Polycomb protein SCMH1 Sex comb on midleg homolog 1 Scmh1 protein protein mouse Mus musculus Mouse MLVCYSVLACESLWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFKQSYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSSEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPIKIFHKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGAEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPPGTKVVIPKNPSPSSDVSTEKPSIHSTKTVLEHQPGQRGRKPGKKRGRTPKILIPHPTSTPSKSAEPLKFPKKRGPKPGSKRKPRTLLSPPPTSPTTSTPEPDTSTVPQDAATVPSSAMQAPTVCIYLNKSGSTGPHLDKKKIQQLPDHFGPARASVVLQQAVQACIDCAYHQKTVFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEKLCHNLRSDNLFGNQPFTQTHLSLTATEYNHNHDRYLPGETFVLGNSLARSLETHSDLMDSALKPANLVSTSQNLRTPGYRPLLPSCGLPLSTVSAVRRLCSKGVLKGKKERRDVESFWKLNHSPGSDRHLESRDPPRLSGRDPSSWTVEDVMQFVREADPQLGSHADLFRKHEIDGKALLLLRSDMMMKYMGLKLGPALKLSFHIDRLKQVFWKRETILWSREGLSREVWPISEDTALGHFFSGMDKVFGSLSKR hxa7_mouse Homeobox protein Hox-A7 Homeobox protein Hox-1.1 Hoxa7 Hox-1.1 Hoxa-7 Homeobox protein M6-12 protein protein mouse Mus musculus Mouse MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEEEEEEEEE hxb7_mouse Homeobox protein Hox-B7 Homeobox protein Hox-2.3 Homeobox protein MH-22B Hoxb7 Hox-2.3 Hoxb-7 Homeobox protein MuB1 protein protein mouse Mus musculus Mouse MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASVQGLYSGGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEAEEEEEE hxc8_mouse Homeobox protein Hox-C8 Homeobox protein Hox-3.1 Hoxc8 Hox-3.1 Hoxc-8 Homeobox protein M31 protein protein mouse Mus musculus Mouse MSSYFVNPLFSKYKGGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD hxc9_mouse Homeobox protein Hox-C9 Hoxc9 Hox-3.2 Hoxc-9 Homeobox protein Hox-3.2 protein protein mouse Mus musculus Mouse MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGDGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS hxa10_mouse Homeobox protein Hox-A10 Hoxa10 Hox-1.8 Hoxa-10 Homeobox protein Hox-1.8 protein protein mouse Mus musculus Mouse MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHGGVYLPPASDLPYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWLDAPRSCRMEPPDGPPPPQPQPQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLYDAADKCPKGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQAYGTAKGFGSGGGGTQQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEAHASSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS geminin-hoxd10-2 Interaction detected by GST pull down. 143989 N/A 143991 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 143992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false geminin-hoxa11-2 Interaction detected by GST pull down. 143989 N/A 143993 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 143992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false geminin-scmh1-2 Interaction detected by GST pull down 143989 N/A 143994 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 143992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false geminin-hoxa7 Interaction detected by GST pull down 143989 N/A 143992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 143995 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false geminin-hoxb7-1 Interaction detected by GST pull down 143989 N/A 143992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 143996 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false geminin-hoxc8-1 Interaction detected by GST pull down 143989 N/A 143992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 143997 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false geminin-hoxc9-1 Interaction detected by GST pull down 143989 N/A 143992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 143998 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false geminin-hoxa10-1 Interaction detected by GST pull down 143989 N/A 143992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 143999 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false geminin-hoxd10-1 Interaction detected by Y2H. 143990 N/A 143992 unspecified role unspecified role bait bait N/A 143991 unspecified role unspecified role prey prey physical association physical association false false false geminin-hoxa11-1 Interaction detected by Y2H. 143990 N/A 143992 unspecified role unspecified role bait bait N/A 143993 unspecified role unspecified role prey prey physical association physical association false false false geminin-scmh1-1 Interaction detected by Y2H. 143990 N/A 143994 unspecified role unspecified role prey prey N/A 143992 unspecified role unspecified role bait bait physical association physical association false false false