IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bhattachary-2003-1 Structure of the Ca2+/S100B/NDR kinase peptide complex: insights into S100 target specificity and activation of the kinase. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bhattacharya S., Large E., Heizmann CW., Hemmings B., Chazin WJ. Biochemistry (0006-2960) 2003 s100b_bovin Protein S100-B S100B S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein bovin Bos taurus (Bovine) Bovine MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE stk38_human Serine/threonine-protein kinase 38 NDR1 STK38 NDR1 protein kinase Nuclear Dbf2-related kinase 1 protein protein human Homo sapiens Human MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK stk38-s100b-1 Interaction between STK38, S100B, Ca2+ determined by NMR 165277 N/A 165278 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 N/A 165279 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 direct interaction direct interaction false false false Poor folding of STK38 N-terminal domain gave low resolution spectra stk38-s100b-2 Interaction between STK38, S100B, Ca2+ determined by NMR 165277 N/A 165278 unspecified role unspecified role neutral component neutral component ile47 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false val52 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false val56 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false ala83 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false cys84 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false phe87 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false phe88 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 N/A 165279 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false leu86 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false phe76 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false leu86 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false phe76 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false phe76 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false leu86 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false leu86 binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 2.0 165298 165293 165299 165288 165300 165292 165301 165290 165302 165291 165303 165294 165304 165295 direct interaction direct interaction false false false S100B binds Ca2+ at both N- and C-terminal loop