IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ minakhina-2003-2 Tamo selectively modulates nuclear import in Drosophila. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Minakhina S., Yang J., Steward R. GST pull-down was used to show that tamo specifically interacts with other proteins which contain a nuclear localization signal (NLS) and that it contains an RanGDP binding domain. The dorsal Rel homology region (RHR) was used as bait in an ovarian cDNA library. Genes Cells (1356-9597) 2003 minakhina-2003-1 Tamo selectively modulates nuclear import in Drosophila. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Minakhina S., Yang J., Steward R. The dorsal Rel homology region (RHR) was used as bait in an ovarian cDNA library. Genes Cells (1356-9597) 2003 minakhina-2003-3 Tamo selectively modulates nuclear import in Drosophila. drome Drosophila melanogaster (Fruit fly) Fruit fly coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Minakhina S., Yang J., Steward R. The dorsal Rel homology region (RHR) was used as bait in an ovarian cDNA library. Genes Cells (1356-9597) 2003 minakhina-2003-4 Tamo selectively modulates nuclear import in Drosophila. in vitro In vitro affinity techniques affinity technology affinity techniques predetermined predetermined participant predetermined Minakhina S., Yang J., Steward R. Gel shift assays were performed to confirm the tamo-dorsal interaction observed in the Y2H screen and to determine the interacting domain of dorsal. The dorsal Rel homology region (RHR) was used as bait in an ovarian cDNA library. Genes Cells (1356-9597) 2003 tamo_drome Protein tamozhennic tamo CG4057 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDFVPHDLIPDLWDEILRRHWMFLETEESIEKLEERKQLEGCLKEFLCVVQHDRKFFLPETGHVLRRSVLELPDFSAQNAIVAFETISQYANNLFTKPWRKEYRTLKTYSGCFQHDIQSRLLDAEQLFLAMGYRRAAEDTFVLEGPICPDQVTNVSRDAMAAYVECQIMKHIYAGVTAAGYVCTWKDILQFRERYVGGTSTTIKEMVRQLSEKRVRMEQPPMQENTYSNVVSAAPTACGMRSNNVAHHPSSSGTCALHPNGLNEAGKYLPPYPAPPPQQPHLPGPLMTHSRSLDHYQEPQAHLPHRHSFDQQLQQQCQLPHVYEAPYDCLDGLSMGSSASYAAVTGAYNAPGNRYPLPYNISSQLNAPYASPADFYGNGQHTNMYATLGKTGPAHSCDLHRRQPNTSAAAAAALAAMQHRQSTYPPDHHLIDFDERAHLTQHDFGTHDYDPQYAELRGQVQPSMRGNPVAMYATYGGYDLPTTLPQAPPPTGQDMYIYARPVPKSSRMRALAEAGGINSTDKHPRSAEKQSTMDNNRKMHKELKERNSRTAPAKRSGTERDIPTTISDLNSYDSASLDGFVALDSSSSPPLMPKVQEGVGSFESWNYVFKNLERSGYTKDLGDREDLLVQSLDLGSLSITNGGAAPPAEKRREATNPTNGEKARTLDKKSGTGRREAKVVQAPAPSPLPNSSSAGVKKVKSALKTAVVDNRGTGSRQRTGAVPKQPPNVSPQLIVTSPNEWSCSFCTFLNPDTKRICEMCCRSKDFNLEAASAASSSAAAAAASAASVSHASSTCV dors_drome Embryonic polarity protein dorsal dl CG6667 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFPNQNNGAAPGQGPAVDGQQSLNYNGLPAQQQQQLAQSTKNVRKKPYVKITEQPAGKALRFRYECEGRSAGSIPGVNSTPENKTYPTIEIVGYKGRAVVVVSCVTKDTPYRPHPHNLVGKEGCKKGVCTLEINSETMRAVFSNLGIQCVKKKDIEAALKAREEIRVDPFKTGFSHRFQPSSIDLNSVRLCFQVFMESEQKGRFTSPLPPVVSEPIFDKKAMSDLVICRLCSCSATVFGNTQIILLCEKVAKEDISVRFFEEKNGQSVWEAFGDFQHTDVHKQTAITFKTPRYHTLDITEPAKVFIQLRRPSDGVTSEALPFEYVPMDSGKHTFWNLHRHLKRKPDEDLFQQILRLDAKREVQPPTIEVIDLDTPKIDVQREIPSEMEFNHEESQQSEPALEQEQSVQQEQYTQEQSLQQEQYTQEQSLQQEQYLQQLEQQQSFQLEEPMQQDQELPAQQSFDQAIDHLPDHTSDHIPEDMEAADAHAEAEAHRLRSEQEKEIDTIIDEKVRELEQLDLGQQLEPRPLTANDKITEWMKSSEIEQQVHEPSPTAEADVLDSALEISKADKTLDELLETVAELDEIYTDFKVQRDTYKNTIQNELAGLQGRAPLQVEDSFDDAATYTSLQIAFKNPVLIPMDDIMPPTPPMSQCAPEDAHQHYDPVEVNSQARKPETPMRPVPPVPPAILTIQYPPEEDKLPPLPPKRIRKQDSNAENRSIEANTVQTKPSTGESPLNKRLPPAPKNPNFNTLPRQKKPGFFSKLFSRRKSKPDLAQGQENSSILDSKANSREPSIGHFNMQDPMRASLRSSKSAAPFISNPAPAKSSPVKAKKPGSKLTKPVGRSVSSVSGKRPAYLNADVVHIPLKGDSVNSLPQQQRTEGYSQSSTISVGAGLDRRTASALQLADIPISEGGMELVAIADRQSLHNLVSSIEGHFNVQLDPNLDLTEAEHFALYTSIPPLAAASEFDETSAYYAPVDAGEILTPDEVAKRLAAANGI msl1_drome Protein male-specific lethal-1 msl-1 CG10385 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDKRFKWPPKKRANYLESPYPHIPSRGRQRNLHGHPNQTQHLHQHPGKIYERQQYGNGRGGHGGGNNNYRKLLHSLPAEHGGGAMAPPSSGGTVCAGADMVKLISENNNLRRMVMLNLNLMQEQTDSIAAKDKELDDQSAKMSVVKAQNEELKQAVAQLEAANQELCKQLRRKNQRRNDNDDDDDDPPLPPAAPQQKLIRCHAETQTVFREREQGTQTIDAQPQFANALPRGINMKESPALDHHAGAVTNQPASKRSESKGRGEFNGKKVSTFILQRMNQDFEHHIHEQTEVAEEHEMEAHKEQISQEEDQLVAEEDHLHMQEVHTEEVVGGDIFHDALESIEMEVVTEELVDMEEHGQSVDANGHIEEDDDEDDEDDENSDKDDDSEEDDYPWMHSDADVNARTEEELWQNQNYLLELDPTEEKTCAPSAHSTPNHQQKSSTQAEIRKEGNQNRITEKLLQLKPEPMVDALEAPILPKWVAFKKKDKEHESVPESPEVPKQQPHQEDAIVDHNAIKNQLEVPKPDLKPKDQPKDEQRQDGQLDVRVEPQEDVRKVQKETLKRQPEDAPKHLPKAVAPKVTKTSSRESTLPKANTADIKDAPAQKVIANHQSTKTQTDPVKTQRLQVKIRQYEMHPDMRTGSSAPSDIRKQKNVDPVSTPETKTIKSKSMLVNDKKTTSETSQSPDQEIDVETVRRKLAEHLKKELLSQSHSSQVTLKKIRERVATNLIYPPPSAPVSSTTITPAPTPSTTPTPGSTPQHAVTSSMDQEISAAKSKSKAAEQIATPLTPQSNSSVSSTTSTIRKTLNNCSPHTYSKATARSGKLQSRFRTATFPYSTRTWEDQEFHCDNEFFLEEADELLADNPSLEIPKWRDVPVPPSSDKIDTELLSDATFERRHQKYVKDEVDRKCRDARYMKEQIRLEQLRMRRNQDEVLVALDPLRASTFYPLPEDIEAIQFVNEVTVQAFGENVVNMEARDDFGVPWVDAIEAPTSIARSKALAEPVATLASKKIPTTAAEARHQENHSSYVFPKRRKRQKNR nup88_drome Nuclear pore complex protein Nup88 mbo Nup88 Nucleoporin Nup88 dNup88 88 kDa nuclear pore complex protein Protein members only CG6819 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSLTDVLELNKTELFAKIRNGLPVVQRTQNLLDCKDDLLFAWHAKDSCLLVRNWRSSLAAKVNIQFQTLIPSSLVSLEVDRVLASNEGSLVALSGPRGVVIMELPRRWGPDGYYKDGKPVITCRTFGLDTQLFLKNPHLEVRQVRWHPHSVSDSTLLVLLNNNTIRVYNHSKLRHVWQVGPPVLRSGANNSLCDFGELAVDFDIAPAAKPRVTEPETAGNNETTLDKSNKTLVAAKSLPKQERIEWPMVVLRENGNIYILMTGVDSENTRLQGPVTITPQAHDNYGLESCALMIIPSLPPTIVIAESNGKLHHALLMEAEATEHSFNEVDDSVLIEPAEYVVHVLETVELELGISAPATGKEGGNCPIYLKRDLINELRYFAYHNAGLHAVTVSFIAELQRYLESESDEDRLELAVSASAEYILCTKFDSSETVNAVFGLALLQIPAGIVLLLGSGQVISLKLVIDAQLLVTPNENKPVDSEVSQQESGPPFVDTIKSLLQRSVNQPILADKLSSPSAQESFELLNQAIEVLREQYLKRHDLVRAAFTRHINQIQLKKEQQLQEIQDLEQERELISERAHKLAERFEEISYNQELLVRKCNALMQRANASLPNSVIAEREFSQEVIRLNKVTQSLAAGLETAKKTFNKQRYHIAQSQEDLKKNAYELPEKQHRTITEILTQLTGEIDRQITDVKRINKIVGI ran_drome GTP-binding nuclear protein Ran Ran Ran10A Ras-related nuclear protein CG1404 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQAQIERDLQEAQATALPDEDEEL ranl_drome GTP-binding nuclear protein Ran-like Ran-like CG7815 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQPQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSRQVESLFNEAKSKPLPTIYDIDL tamo-dorsal-2 Interaction detected by GST-pulldown 164588 N/A 164592 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 164593 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Shows that tamo interacts with dorsal which contains an NLS. tamo-tamo-1 Interaction detected by GST-pulldown 164588 N/A 164592 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 164592 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Shows that tamo interacts with itself due to the NLS. tamo-msl1-1 Interaction detected by GST-pulldown 164588 N/A 164594 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 164592 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Shows that tamo interacts with msl-1 which contains an NLS. tamo-nup88-1 Interaction detected by GST-pulldown 164588 N/A 164595 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 164592 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Shows that tamo interacts with nup88 which contains an NLS. tamo-ran-1 Interaction detected by GST-pulldown 164588 N/A 164592 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 164596 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Tamo was N-terminally deleted of AA 25-613 to make it more stable (since full-length tamo is cleaved at ~AA 760) and retain the RanGDP binding domain (at AA 738-766). Shows that tamo interacts with ran-1. tamo-ranl-1 Interaction detected by GST-pulldown 164588 N/A 164597 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 164592 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Tamo was N-terminally deleted of AA 25-613 to make it more stable (since full-length tamo is cleaved at ~AA 760) and retain the RanGDP binding domain (at AA 738-766). Shows that tamo interacts with ran-like. tamo-dorsal-1 Interaction detected by Y2H 164589 N/A 164592 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 164593 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false Tamo interacts with the dorsal RHR (Rel homology region). tamo-dorsal-3 Interaction detected by western blot of coimmunoprecipitation 164590 N/A 164592 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 164593 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false Tamo and dorsal interact in the cytoplasm. tamo-dorsal-4 Interaction detected by gel shift assays 164591 N/A 164593 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 164592 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false A 32-P end-labelled double-stranded zen B DNA fragment (TAACTGGGAGAAACCCAATCA) was present during the interaction. Both the dorsalRHR and the dorsalRHR with a deletion of the 6AA NLS effectively bind the labelled DNA. Result indicates that tamo-dorsal interaction requires the NLS. Tamo inhibits the dorsal-DNA binding of the wild type dorsal but not when the NLS is deleted.