IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ blanton-2003-1 Protein:protein interactions and the pairing of boundary elements in vivo. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Blanton J., Gaszner M., Schedl P. Genes Dev. (0890-9369) 2003 blanton-2003-2 Protein:protein interactions and the pairing of boundary elements in vivo. in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Blanton J., Gaszner M., Schedl P. Genes Dev. (0890-9369) 2003 blanton-2003-3 Protein:protein interactions and the pairing of boundary elements in vivo. drome Drosophila melanogaster (Fruit fly) Fruit fly coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Blanton J., Gaszner M., Schedl P. Drosophila embryo extract used in experiment. Genes Dev. (0890-9369) 2003 q9u9d0_drome dwg zw5 CG2711 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSKIAEVVVLNCRTCTRACKLHKPLQEEIDLGSEGSTTLASMLNYCTGLSFEPQDGAAMPQHICLHCLQLLEQAFNFKRMVIDSDELLRLGLDEARCSSFHESQTHSPNQSQQHDQQQQAFDSTEEYVMIEMLNEEQENVANLDEELAEEDRRIFAMTVDEEEEFLTEEVDQDDELSEEEHQLAQSGDQQEEHITMESVHEFQPAEVEYVTIKNEFETIVTEEDEFEVMNDSGAHDAILDCQMIVIPAEGAIDEVIGEETLEMEGDGREEHLLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKEFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAVQSINPPSRQAGAEGATGGGATGGSPTGGGATGGSATNLHITEVHEQPVSTSKVVMVL q7jn06_drome BEAF BEAF-32B BEAF32 BEAF32A BEAF32B BEAF32b Beaf-32 Beaf32 Dmel\CG10159 beaf bs04c01.y1 CG10159 Dmel_CG10159 BEAF-32 BEAF-32A BEAF 32 beaf-32 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHVEKKSELRSLLKSGDKRCKLVEPRNTKSCVWRFFNLVQCDDHIEPYACCKTCGDLLSYSGKTGTGSLLRHRCLHSSSSNDKTVRITKAKTLREPLRVAKPKIESNVANYLGEAGALPQKWEEYEQNDEISEDIKDIIYSEDPLCYSPIHVMDDEGLDQPEKQVTVLTHSTSPAGGSSRPIGVGSGVQATVVASTSSSSSSAKQLKNNLETSIERLTAVSEQLSYIIQQNHEELTKDDDYYFALSLVPAMRHLSLSRKMYVRSKIQDILFKESEDSTLAKDE q94513_drome BEAF-32 BEAF-32B BEAF 32 beaf-32 BEAF BEAF-32A BEAF32 BEAF32A BEAF32B BEAF32b Beaf-32 Beaf32 Dmel\CG10159 beaf bs04c01.y1 CG10159 Dmel_CG10159 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPKGRVSNVWQHYDINEECENFAICRYCGNNISRGGMASNLKGNNTTNLWTHLRHKHRDEVLVSPVQQRPQARMIPIIKKDKTVRITKAKTLREPLRVAKPKIESNVANYLGEAGALPQKWEEYEQNDEISEDIKDIIYSEDPLCYSPIHVMDDEGLDQPEKQVTVLTHSTSPAGGSSRPIGVGSGVQATVVASTSSSSSSAKQLKNNLETSIERLTAVSEQLSYIIQQNHEELTKDDDYYFALSLVPAMRHLSLSRKMYVRSKIQDILFKESEDSTLAKDE dwg-beaf32-1 Interaction determined by GST pull down. 131599 N/A 131602 unspecified role unspecified role prey prey N/A 131603 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false BEAF-32A was GST tagged. dwg-beaf32-2 Interaction determined by GST pull down. 131599 N/A 131603 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131602 unspecified role unspecified role prey prey physical association physical association false false false Drosophila nuclear extract used. BEAF-32A is GST tagged dwg-beaf32-3 Interaction determined by GST pull down. 131599 N/A 131603 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131602 unspecified role unspecified role prey prey physical association physical association false false false BEAF-32A was GST tagged. C terminal of BEAF 32 (common between BEAF32A and BEAF32B) was used in the interaction. dwg-beaf_32-2 Interaction detected by invitro CoIP. 131600 N/A 131604 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 131602 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false Monoclonal antibodies against dwg used to pull down GST tagged Beaf-32A. dwg-beaf_32-3 Interaction detected by in vivo CoIP. 131601 N/A 131602 unspecified role unspecified role bait bait N/A 131603 unspecified role unspecified role prey prey physical association physical association false false false