IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gohla-2002-2 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Gohla A., Bokoch GM. Curr. Biol. (0960-9822) 2002 gohla-2002-1 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. in vitro In vitro biochemical biochemical fingerprinting peptide massfingerprinting fingerprinting Gohla A., Bokoch GM. Curr. Biol. (0960-9822) 2002 gohla-2002-3 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Gohla A., Bokoch GM. 14-3-3 is biotinylated and couples to streptavidin-agarose beads Curr. Biol. (0960-9822) 2002 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN cof1_human Cofilin-1 CFL1 CFL Cofilin, non-muscle isoform 18 kDa phosphoprotein protein protein human Homo sapiens Human MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL limk1_human LIM domain kinase 1 LIMK1 LIMK protein protein human Homo sapiens Human MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD 1433z_bovin 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 Factor activating exoenzyme S protein protein bovin Bos taurus (Bovine) Bovine MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN cof1a_xenla Cofilin-1-A cfl1-a ADF/cofilin-1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MASGVMVSDDVIKVFNEMKVRHQLSPEDAKKRKKAVVFCLSDDKKTIILEPGKEILQGDIGCNVEDPYKTFVKMLPRNDCRYALYDALYETKETKKEDLVFVFWAPEEASLKSKMIYASSKDAIKKRLPGIKHEWQINTYEDVNDPCNLADKLGGNTVVSLEGKSVRS ywhaz-cof1-1 GST pull-down: bait= human 14-3-3, prey= human cofilin 143941 N/A 143944 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 143945 unspecified role unspecified role prey prey P23528:p.[Ser3Ala;Ser23Ala;Ser24Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ser phosporylation required phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association false false false Overexpression of a constitutively active fragment of limk1 (302-647, kinase domain) increases the cofilin /14-3-3 association, probably by phosphorylation of cofilin. ywhaz-limk1 GST pull-down: bait= human 14-3-3, prey= human limk1 143941 N/A 143944 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 143946 unspecified role unspecified role prey prey active kinase binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false constitutively active fragment (302-647) of LIMK1 is used association is reduced when Cos1 cells are treated with phosphatases PP1/PP2A ywhaz-xac1 identification of 14-3-3 zeta as a binding factor of cofilin in bovin brain cytosol 143942 N/A 143947 unspecified role unspecified role prey prey N/A 143948 unspecified role unspecified role bait bait phosphotylated ser3 required phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false P45695:p.Ser3Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false cofilin is purified from bovine brain cytosol ywhaz-cof1-2 affinity chromatography: bait= human 14-3-3, prey= human cofilin 143943 N/A 143945 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false iodine125 radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 143944 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false 143943 Kd is estimated using the best fit: a one-binding site model