IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brower-2002-1 Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Brower CS., Sato S., Tomomori-Sato C., Kamura T., Pause A., Stearman R., Klausner RD., Malik S., Lane WS., Sorokina I., Roeder RG., Conaway JW., Conaway RC. The yeast strain used for this study constitutively expresses Elongin C. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 brower-2002-4 Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase. spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Brower CS., Sato S., Tomomori-Sato C., Kamura T., Pause A., Stearman R., Klausner RD., Malik S., Lane WS., Sorokina I., Roeder RG., Conaway JW., Conaway RC. The yeast strain used for this study constitutively expresses Elongin C. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 brower-2002-3 Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Brower CS., Sato S., Tomomori-Sato C., Kamura T., Pause A., Stearman R., Klausner RD., Malik S., Lane WS., Sorokina I., Roeder RG., Conaway JW., Conaway RC. The yeast strain used for this study constitutively expresses Elongin C. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 brower-2002-2 Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Brower CS., Sato S., Tomomori-Sato C., Kamura T., Pause A., Stearman R., Klausner RD., Malik S., Lane WS., Sorokina I., Roeder RG., Conaway JW., Conaway RC. The yeast strain used for this study constitutively expresses Elongin C. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 elob_human Elongin-B ELOB Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 TCEB2 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ med8_human Mediator of RNA polymerase II transcription subunit 8 MED8 Mediator complex subunit 8 Activator-recruited cofactor 32 kDa component protein protein human Homo sapiens Human MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISKEERESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC cul2_mouse Cullin-2 Cul2 protein protein mouse Mus musculus Mouse MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYAETKIFLESHVRHLYKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHSECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH med17_human Mediator of RNA polymerase II transcription subunit 17 TRAP80 MED17 ARC77 DRIP80 Mediator complex subunit 17 Cofactor required for Sp1 transcriptional activation subunit 6 Transcriptional coactivator CRSP77 Vitamin D3 receptor-interacting protein complex 80 kDa component Thyroid hormone receptor-associated protein complex 80 kDa component Activator-recruited cofactor 77 kDa component CRSP6 DRIP77 protein protein human Homo sapiens Human MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLCHSSNDKKSQKFATEKQCPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINSLQSSEGLLEKIIKQAKHIFLRSRAAATIDSLASRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL med10_human Mediator of RNA polymerase II transcription subunit 10 MED10 L6 TRG17 Mediator complex subunit 10 Transformation-related gene 17 protein Transformation-related gene 20 protein TRG20 protein protein human Homo sapiens Human MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS tceb2-med8-1 interaction detected by Y2H in yeast expressing EloC 141973 N/A 141977 unspecified role unspecified role bait bait N/A 141978 unspecified role unspecified role prey prey physical association physical association false false false EloC: Q15369 essential for this interaction. tceb1-med8-1 interaction detected by Y2H in yeast expressing EloC 141973 N/A 141978 unspecified role unspecified role bait bait N/A 141979 unspecified role unspecified role prey prey physical association physical association false false false EloB: Q15370 essential for this interaction. tceb2-med8-2 interaction detected by Y2H in yeast expressing EloC 141973 N/A 141978 unspecified role unspecified role bait bait N/A 141977 unspecified role unspecified role prey prey physical association physical association false false false EloC: Q15369 essential for this interaction. tceb1-tceb2-3 Interaction of Med8 with EloB and EloC. 141974 N/A 141977 unspecified role unspecified role prey prey N/A 141980 unspecified role unspecified role bait bait N/A 141978 unspecified role unspecified role prey prey N/A 141981 unspecified role unspecified role prey prey association association false false false The Elongin BC-box motif SLNKMCSNLL located between AA 142-151 important for this interaction. Epitope tagged T7-MED8, HA-Cul2, HPC4-EloB, HSV-EloC, Myc-Rbx1 proteins used in the study tceb1-tceb2-4 Interaction of Med8 with EloB and EloC. 141974 N/A 141978 unspecified role unspecified role bait bait N/A 141977 unspecified role unspecified role prey prey N/A 141979 unspecified role unspecified role prey prey N/A 141981 unspecified role unspecified role prey prey association association false false false The Elongin BC-box motif SLNKMCSNLL located between AA 142-151 important for this interaction. Epitope tagged T7-MED8, HA-Cul2, HPC4-EloB, HSV-EloC, Myc-Rbx1 proteins used in the study tceb1-tceb2-5 Interaction of Med8 with EloB and EloC. 141974 N/A 141978 unspecified role unspecified role prey prey N/A 141977 unspecified role unspecified role prey prey N/A 141979 unspecified role unspecified role prey prey N/A 141981 unspecified role unspecified role bait bait association association false false false The Elongin BC-box motif SLNKMCSNLL located between AA 142-151 important for this interaction. Epitope tagged T7-MED8, HA-Cul2, HPC4-EloB, HSV-EloC, Myc-Rbx1 proteins used in the study tceb1-tceb2-1 Interaction of Med8 with EloB and EloC. 141975 N/A 141979 unspecified role unspecified role prey prey N/A 141978 unspecified role unspecified role prey prey N/A 141977 unspecified role unspecified role bait bait association association false false false Epitope tagged T7-MED8, myc-EloB, HSV-EloC proteins used in the study The Elongin BC-box motif SLNKMCSNLL located between AA 142-151 important for this interaction. tceb1-tceb2-2 Interaction of Med8 with EloB and EloC. 141975 N/A 141977 unspecified role unspecified role prey prey N/A 141979 unspecified role unspecified role prey prey N/A 141978 unspecified role unspecified role bait bait association association false false false Epitope tagged T7-MED8, myc-EloB, HSV-EloC proteins used in the study The Elongin BC-box motif SLNKMCSNLL located between AA 142-151 important for this interaction. med8-nut2-1 interaction detected by CoIP. 141976 N/A 141982 unspecified role unspecified role prey prey N/A 141978 unspecified role unspecified role prey prey N/A 141983 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false