MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kutuzov-2001-1 Interaction of plant protein Ser/Thr phosphatase PP7 with calmodulin. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kutuzov MA., Bennett N., Andreeva AV. m.kutuzov@usa.net Biochem. Biophys. Res. Commun. (0006-291X) 2001 ppp7_arath Serine/threonine-protein phosphatase 7 PP7 MGI19.7 At5g63870 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METVPPSPITWPDGGALTNDWVHGLMSCFEWSSWNLPPSQLPSLLPVNVFDSLVLTAHKILHKERNCVHIDDLDSVSNVVVVGDIHGQLHDLLFLLKDTGFPCQNRCYVFNGDYVDRGAWGLETFLVLLSWKVLMPDRVYLLRGNHESKYCTSMYGFEKEVLTKYGDKGKHVYRKCLGCFEGLPLASIISGRVYTAHGGLFRSPVLPKRTTRGKKNRRVVLLEPEPSSMKLGTLDELMQARRSVLDPPWEGSNLIPGDVLWSDPSMTPGLSPNEQRGIGLLWGPDCTEDFLKKYELKLIIRSHEGPDAREKRTGLGGMDNGYTIDHNVESGKLITIFSAPDYPQFQATEERYKNKGAYIILQAPDFSDPQFHSFEAVKPRPKAHPYYDFENVIDSDDEMDKSAMDTNNEQPNS mint Phosphatase active on para-nitrophenylphosphate (pNPP) and on various phosphoproteins such as myelin basic protein. Seems to act as a positive regulator of cryptochrome signaling involved in hypocotyl growth inhibition and cotyledon expansion under white and blue light conditions. Confers thermotolerance. Required for heat shock mediated-signaling pathway that leads to the expression of heat shock proteins (HSPs) calm1_arath Calmodulin-1/4 CAM1 At5g37780 K22F20.2 T31G3.3 CAM4 At1g66410 T27F4.1 F28G11.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK pp7-cam1 104111 ppp7_arath 104112 primer specific pcr primer specific pcr unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false Stoichiometry: 1.0 calm1_arath 104113 primer specific pcr primer specific pcr unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint