DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lake-2001-1 Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lake MW., Wuebbens MM., Rajagopalan KV., Schindelin H. Nature (0028-0836) 2001 IMEx Only protein-protein interactions imex curation moad_ecoli Molybdopterin synthase sulfur carrier subunit Molybdenum cofactor biosynthesis protein D Molybdopterin-converting factor small subunit moaD chlA4 chlM b0784 JW0767 MPT synthase subunit 1 Molybdopterin-converting factor subunit 1 Sulfur carrier protein MoaD protein protein ecoli Escherichia coli (strain K12) MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG moeb_ecoli Molybdopterin-synthase adenylyltransferase moeB chlN b0826 JW0810 Molybdopterin-converting factor subunit 1 adenylase MoaD protein adenylase Sulfur carrier protein MoaD adenylyltransferase protein protein ecoli Escherichia coli (strain K12) MAELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGENALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEVCGQ atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) amp Adenosine monophosphate 5'-Adenosine monophosphate 5'-Adenylic acid 5'-AMP 5'-O-phosphonoadenosine adenosine 5'-(dihydrogen phosphate) Adenosine 5'-monophosphate Adenosine 5'-phosphate ADENOSINE MONOPHOSPHATE adenosine phosphate Adenosine-5'-monophosphoric acid adenosine-5'P adenosini phosphas Adenylate Adenylic acid Ado5'P AMP fosfato de adenosina pA PAdo phosphate d'adenosine 5'-adenylic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) moab-moed-1 Structure of the native moeb-moad protein complex 99803 n/a 99804 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 99805 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 99812 99810 direct interaction direct interaction false false false tetrameric working 82.500%, free 79.100% 1.7A Fig. 1, Table 1 moab-moad-atp Structure of the atp-bound moeb-moad protein complex 99803 n/a 99806 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 99805 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 99804 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false tetrameric working 79.700%, free 73.200% 2.9A Fig. 2a, Table 1 moab-moad-amp Structure of the covalent acyl-adenylate form of the moeb- moad protein complex 99803 n/a 99807 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 99804 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 99805 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false tetrameric working 81.200%, free 77.500% 2.1A Fig. 2b, Table 1