MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint babst-2000-2 Mammalian tumor susceptibility gene 101 (TSG101) and the yeast homologue, Vps23p, both function in late endosomal trafficking. in vivo in vivo affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Babst M., Odorizzi G., Estepa EJ., Emr SD. Traffic (1398-9219) 2000 stp22_yeast Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease STP22 VPS23 YCL008C YCL8C Vacuolar protein sorting-associated protein 23 ESCRT-I complex subunit VPS23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSANGKISVPEAVVNWLFKVIQPIYNDGRTTFHDSLALLDNFHSLRPRTRVFTHSDGTPQLLLSIYGTISTGEDGSSPHSIPVIMWVPSMYPVKPPFISINLENFDMNTISSSLPIQEYIDSNGWIALPILHCWDPAAMNLIMVVQELMSLLHEPPQDQAPSLPPKPNTQLQQEQNTPPLPPKPKSPHLKPPLPPPPPPQPASNALDLMDMDNTDISPTNHHEMLQNLQTVVNELYREDVDYVADKILTRQTVMQESIARFHEIIAIDKNHLRAVEQAIEQTMHSLNAQIDVLTANRAKVQQFSSTSHVDDEDVNSIAVAKTDGLNQLYNLVAQDYALTDTIECLSRMLHRGTIPLDTFVKQGRELARQQFLVRWHIQRITSPLS FEDE3BE79F063BCE vps28_yeast Vacuolar protein sorting-associated protein 28 VPS28 VPT28 YPL065W LPE5W ESCRT-I complex subunit VPS28 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQKHNIKLNQNQDISQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFCDTYNITASNAITRLERGIPITAEHAISTTTSAPSGDNKQSSSSDKKFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD DE091D3F60C9D132 stp22-vps28 143677 stp22_yeast 143674 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 vps28_yeast 143675 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false homomint mint stp22-vps28-1 143673 stp22_yeast 143674 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 vps28_yeast 143675 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false homomint mint