MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint morreale-2000-1 Structure of Cdc42 bound to the GTPase binding domain of PAK. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Morreale A., Venkatesan M., Mott HR., Owen D., Nietlispach D., Lowe PN., Laue ED. Nat. Struct. Biol. (1072-8368) 2000 pak1_rat Serine/threonine-protein kinase PAK 1 p21-activated kinase 1 p68-PAK Alpha-PAK Protein kinase MUK2 Pak1 protein protein rat Rattus norvegicus (Rat) Rat MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL cdc42-pak1-7 NMR: structure of cdc42 in complex with PAK1 99912 N/A 99913 unspecified role unspecified role neutral component neutral component crib binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gly ser tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false leu107 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false leu107 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 99914 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false glu61leu binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false leu67 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false leu70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 99924 99919 99925 99920 direct interaction direct interaction false false false cdc42 is bound to GMPPNP (guanylyl-5'-imidophosphate)