MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint missero-2000-1 Multiple ras downstream pathways mediate functional repression of the homeobox gene product TTF-1. in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Missero C., Pirro MT., Di Lauro R. Mol. Cell. Biol. (0270-7306) 2000 missero-2000-2 Multiple ras downstream pathways mediate functional repression of the homeobox gene product TTF-1. in vivo in vivo anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Missero C., Pirro MT., Di Lauro R. Mol. Cell. Biol. (0270-7306) 2000 nkx21_rat Homeobox protein Nkx-2.1 Nkx2-1 Nkx-2.1 Ttf1 Ttf-1 Titf1 Thyroid transcription factor 1 Thyroid nuclear factor 1 protein protein rat Rattus norvegicus (Rat) Rat MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQQQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGAMSCSTLLYGRTW mk01_mouse Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein mouse Mus musculus Mouse MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS mapk1-nkx2_1 131623 nkx21_rat 131625 polyclonal western polyclonal antibody western blot polyclonal western enzyme target enzyme target substrate substrate unspecified role unspecified role over-expressed over expressed level over-expressed undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 mk01_mouse 131626 polyclonal western polyclonal antibody western blot polyclonal western enzyme enzyme unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false detection method = protein kinase assay phosphorylation@18 alanine scanning phosphorylation@328 alanine scanning phosphorylation@337 alanine scanning homomint mint mapk1-nkx2_1-1 131624 mk01_mouse 131626 polyclonal western polyclonal antibody western blot polyclonal western enzyme enzyme unspecified role unspecified role purified purified Stoichiometry: 1.0 nkx21_rat 131625 polyclonal western polyclonal antibody western blot polyclonal western enzyme target enzyme target substrate substrate unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false homomint mint