IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ peyroche-1999-1 Brefeldin A acts to stabilize an abortive ARF-GDP-Sec7 domain protein complex: involvement of specific residues of the Sec7 domain. in vitro In vitro biochemical biochemical predetermined predetermined participant predetermined Peyroche A., Antonny B., Robineau S., Acker J., Cherfils J., Jackson CL. Mol. Cell (1097-2765) 1999 arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK cyh2_human Cytohesin-2 PH, SEC7 and coiled-coil domain-containing protein 2 ARF nucleotide-binding site opener ARF exchange factor CYTH2 ARNO PSCD2L PSCD2 protein protein human Homo sapiens Human MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP arf1-pscd2-1 Gel filtration. Complex between ARNO sec7 domain and Arf1. 146621 N/A 146622 unspecified role unspecified role neutral component neutral component delta17 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 146623 unspecified role unspecified role neutral component neutral component sec7 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Brefeldin A (BFA) increases the amount of complex between ARNO and Arf1. BFA was shown to inhibit 'the exchange activity of Arf1 triggered by ARNO' by an uncompetitive mechanism. BFA is an inhibitor which makes more complexes but inhibits the activity. arf1-pscd2-2 Gel filtration. Complex between ARNO sec7 domain and Arf1. 146621 N/A 146622 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 146623 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Arf1 delta17 is used (18-180) sec7 domain of ARNO is used (50-252) mutations F190Y and A191S were introduced in ARNO to make it more BFA sensitive. Brefeldin A (BFA) increases the amount of complex between the mutated ARNO (F190Y, A191S) and Arf1. BFA was shown to inhibit 'the exchange activity of Arf1 triggered by ARNO' by an uncompetitive mechanism.