MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zha-1996-3 Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. Cell (0092-8674) 1996 partial coverage rapid curation zha-1996-1 Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. Cell (0092-8674) 1996 partial coverage rapid curation zha-1996-2 Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. Cell (0092-8674) 1996 partial coverage rapid curation 1433t_mouse 14-3-3 protein theta Ywhaq 14-3-3 protein tau protein protein mouse Mus musculus Mouse MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ bad-ywhaq-3 11501 1433t_mouse 1433T_MOUSE 11504 unspecified role unspecified role unspecified role unspecified role bad_mouse BAD_MOUSE 11505 unspecified role unspecified role unspecified role unspecified role association association false false false domino mint bad-ywhaq-4 11501 1433t_mouse 1433T_MOUSE 11504 unspecified role unspecified role unspecified role unspecified role bad_mouse BAD_MOUSE 11505 unspecified role unspecified role unspecified role unspecified role association association false false false domino mint ywhaq-bad 11502 1433t_mouse 11504 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 bad_mouse 11505 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false - screening in expression cloning with BAD-GST with Heart Muscle Kinase domain p32 labeled screening an embryonic mouse library , 14-3-3 TAUrn- CoIP with anti BAD, western with anti 14-3-3. In FL5.12, overexpression of BAD and HA-14-3-3rn- Alanine scanning in CoIP overexpressing BAD and HA-14-3-3: each ser can singularly bind 14-3-3rn- When ser mutated bad is expressed, cell die because they interact BAD-Bcl-XLrn domino mint bad-ywhaq-2 11503 1433t_mouse 11504 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 bad_mouse 11505 unspecified role unspecified role unspecified role unspecified role purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 association association false false false - screening in expression cloning with BAD-GST with Heart Muscle Kinase domain p32 labeled screening an embryonic mouse library , 14-3-3 TAUrn- CoIP with anti BAD, western with anti 14-3-3. In FL5.12, overexpression of BAD and HA-14-3-3rn- Alanine scanning in CoIP overexpressing BAD and HA-14-3-3: each ser can singularly bind 14-3-3rn- When ser mutated bad is expressed, cell die because they interact BAD-Bcl-XLrn domino mint