IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sargiacomo-1995-1 Oligomeric structure of caveolin: implications for caveolae membrane organization. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Sargiacomo M., Scherer PE., Tang Z., Kubler E., Song KS., Sanders MC., Lisanti MP. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 cav1_canlf Caveolin-1 CAV1 CAV Vesicular integral-membrane protein VIP21 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET cav1-cav1-1 16548 N/A 16549 unspecified role unspecified role prey prey N/A 16549 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false MDCK cell lysate was used. GST-fusion of aa 1-101 of CAV1 were used as bait. aa 61-101 of CAV1 are sufficient