IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fan-2003-1 Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid western blot western blot Immuno blot Immuno blot Fan X., Labrador JP., Hing H., Bashaw GJ. Neuron (0896-6273) 2003 fan-2003-4 Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fan X., Labrador JP., Hing H., Bashaw GJ. Neuron (0896-6273) 2003 fan-2003-2 Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fan X., Labrador JP., Hing H., Bashaw GJ. Neuron (0896-6273) 2003 fan-2003-3 Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fan X., Labrador JP., Hing H., Bashaw GJ. Neuron (0896-6273) 2003 q24218_drome dock CG3727 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAGNMKHGKSQDDVCYVVAKYDYAAQGAQELDLRKNERYLLLDDSKHWWRVQNSRNQSGYVPSNYVKKEKPSLFDSIKKKVKKGSGSKTLPNCSPSRQVESPTMSRRLPPDPAEAIGTAVVKYNYQAQQPDELSLTKGTRILILEKSNDGWWRGQSGNSVGWFPSNYTTEDCDNDGEIHTYAMAENVLDIVVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRNTSASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDTVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVEQNMYCIGQRKFHSLDQLVDHYQRAPIYTNKQGEKLYLVRSLPKANGT o44924_drome robo1 robo CG13521 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHPMHPENHAIARSTSTTNNPSRSRSSRMWLLPAWLLLVLVASNGLPAVRGQYQSPRIIEHPTDLVVKKNEPATLNCKVEGKPEPTIEWFKDGEPVSTNEKKSHRVQFKDGALFFYRTMQGKKEQDGGEYWCVAKNRVGQAVSRHASLQIAVLRDDFRVEPKDTRVAKGETALLECGPPKGIPEPTLIWIKDGVPLDDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRARILHDEKSLEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQYVAADGTLQITDVRQEDEGYYVCSAFSVVDSSTVRVFLQVSSVDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQTGWIVAAHRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNVIKTIEADFDAASANDLSAARTLLTGKSVELIDASAINASAVRLEWMLHVSADEKYVEGLRIHYKDASVPSAQYHSITVMDASAESFVVGNLKKYTKYEFFLTPFFETIEGQPSNSKTALTYEDVPSAPPDNIQIGMYNQTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNTMKVLANMTLNATTTSVLLNNLTTGAVYSVRLNSFTKAGDGPYSKPISLFMDPTHHVHPPRAHPSGTHDGRHEGQDLTYHNNGNIPPGDINPTTHKKTTDYLSGPWLMVLVCIVLLVLVISAAISMVYFKRKHQMTKELGHLSVVSDNEITALNINSKESLWIDHHRGWRTADTDKDSGLSESKLLSHVNSSQSNYNNSDGGTDYAEVDTRNLTTFYNCRKSPDNPTPYATTMIIGTSSSETCTKTTSISADKDSGTHSPYSDAFAGQVPAVPVVKSNYLQYPVEPINWSEFLPPPPEHPPPSSTYGYAQGSPESSRKSSKSAGSGISTNQSILNASIHSSSSGGFSAWGVSPQYAVACPPENVYSNPLSAVAGGTQNRYQITPTNQHPPQLPAYFATTGPGGAVPPNHLPFATQRHAASEYQAGLNAARCAQSRACNSCDALATPSPMQPPPPVPVPEGWYQPVHPNSHPMHPTSSNHQIYQCSSECSDHSRSSQSHKRQLQLEEHGSSAKQRGGHHRRRAPVVQPCMESENENMLAEYEQRQYTSDCCNSSREGDTCSCSEGSCLYAEAGEPAPRQMTAKNT pak_drome Serine/threonine-protein kinase Pak Pak DPAK Dpak1 CG10295 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSEEDKPPAPPVRLTSNRGGNERSGGGVGVGGGGLGGGGMGDVPPDMRPLPKEPDDSDRKKKTLKSKIKGSKPSHTDSKPNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVLKWFDNTTKQRPSSKYMTNAITTHSGSSLSRVSSSSPSSTPTDSELHGSNSGGNLIGVQLGSMTLGPNANNVAVAGQILGNHYQQQQQHLLQQQQPLLHQNHNQHHMGISQSHSYNFVGHTVSSSTSQHSSANEDDMLGPQHPQQQPPPPPVASRPERTKSIYTRPIEDLQPAIIPMPVAPATTPATPLQNHRTPGGISAPAASPMMHNNATTTLDKNKNNANLYTPEPTVAQVSAGGPSSQVAGNQIAVPQAAVAPAATPNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAAKEATKGN rac1_drome Ras-related protein Rac1 Rac1 RacA CG2248 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL rac2_drome Ras-related protein Rac2 Rac2 RacB CG8556 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCALL q7jws8_drome Mtl 5588 Dmel\CG5588 MTL Mig2-like Mt1 Rac Rac GTPase Rac-like dMig-2 mtl Dmel_CG5588 CG5588 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRKCLIM robo-dock-1 Interaction of AA 939-1345 of ROBO with Dock detected by Y2H. 14404 N/A 14408 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 14409 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cytoplasmic domains of Robo1 (AA 939-1345) was fused to B42. Dock was fused to LexA. dock-pak-1 Interaction detected by Y2H 14404 N/A 14408 unspecified role unspecified role bait bait b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 14410 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Dock was expressed as a P42 fusion product and Pak was expressed as a Lex fusion product. pak-rac1-1 interaction detected by Y2H 14404 N/A 14410 unspecified role unspecified role bait bait b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 14411 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Pak was a B42 fusion protein while Rac1 was a Lex fusion protein. pak-rac2-1 interaction detected by Y2H 14404 N/A 14410 unspecified role unspecified role bait bait b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 14412 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Pak was expressed as a B42 fusion while Rac2 was expressed as a Lex fusion. robo-dock-3 Interaction of Robo1 (AA 1084-1395) with Dock detected by Y2H. 14404 N/A 14409 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 14408 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cytoplasmic domains of Robo1 (AA 1084-1395) was fused to B42. Dock was fused to LexA. robo-dock-4 Interaction of Robo1 (AA 939-1345) with Dock detected by Y2H 14404 N/A 14408 unspecified role unspecified role prey prey b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 14409 unspecified role unspecified role bait bait lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false cytoplasmic domains of Robo1 (AA 939-1345) was fused to B42. Dock was fused to LexA. robo-dock-6 Deletion mutant analysis of Robo interaction with Dock by Y2H. 14404 N/A 14409 unspecified role unspecified role prey prey N/A 14408 unspecified role unspecified role bait bait physical association physical association false false false Proline rich CC2 (1247-1295) and CC3 (1084-1130) motifs are important for interaction. robo-dock-7 Deletion mutants of Dock were analysed by Y2H for interaction with Robo. 14404 N/A 14409 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 14410 unspecified role unspecified role prey prey physical association physical association false false false Domains SH3-1 and SH3-2 were found to be important for interaction. Robo AA 939-1395 was used in the studies. robo-rac1-1 interaction between Robo-Rac1-Pak detected by GST pull down of pak. 14405 N/A 14410 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 14411 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 14409 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association false false false myc tagged robo, HA tagged Rac1 and GST tagged Pzk (AA 77-151) were used in the experiment. The coprecipitation occured only in the presence of Slit. robo-rac2-1 interaction between Robo-Rac2-Pak detected by GST pull down. 14405 N/A 14410 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 14412 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 14409 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association false false false Myc tagged Robo and HA tagged Rac2 were pulled down by GST tagged Pak (AA77-151) in the presence of Slit. robo-mtl-1 interaction between Robo-Mtl-Pak detected by GST pull down. 14405 N/A 14409 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 14410 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 14413 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association false false false myc tagged Robo and HA tagged Mtl were pulled down by GST tagged Pak (AA 77-151) in the presence of Slit. robo-dock-2 coimmunoprecipitation of robo and dock. 14406 N/A 14409 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 14408 unspecified role unspecified role prey prey physical association physical association false false false This interaction is stimulated by treatment of cells by Slit. robo-robo-1 coimmunoprecipitation of myc-Robo and wt-Robo 14406 N/A 14409 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 N/A 14409 unspecified role unspecified role prey prey Stoichiometry: 1.0 physical association physical association false false false myc tagged Robo was used to pull down wild type Robo. robo-dock-5 Interaction of robo-dock-pak detected by coprecipitation. 14407 N/A 14410 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 14409 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 14408 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Robo was his tagged. This activity is Slit dependent.