MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint guo-2003b-1 Humanin peptide suppresses apoptosis by interfering with Bax activation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Guo B., Zhai D., Cabezas E., Welsh K., Nouraini S., Satterthwait AC., Reed JC. Nature (0028-0836) 2003 IMEx Only protein-protein interactions imex curation imex curation guo-2003b-2 Humanin peptide suppresses apoptosis by interfering with Bax activation. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Guo B., Zhai D., Cabezas E., Welsh K., Nouraini S., Satterthwait AC., Reed JC. Nature (0028-0836) 2003 IMEx Only protein-protein interactions imex curation imex curation guo-2003b-3 Humanin peptide suppresses apoptosis by interfering with Bax activation. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Guo B., Zhai D., Cabezas E., Welsh K., Nouraini S., Satterthwait AC., Reed JC. Human testis cDNA Nature (0028-0836) 2003 IMEx Only protein-protein interactions imex curation imex curation hunin_human Humanin HN Humanin mitochondrial MT-RNR2 protein protein human Homo sapiens Human MAPRGFSCLLLLTSEIDLPVKRRA mint Plays a role as a neuroprotective factor against death induced by multiple different types of familial Alzheimer disease genes and beta amyloid in Alzheimer disease. Induced chemotaxis of mononuclear phagocytes by using FPRL1. Reduced the aggregation and fibrillary formation by suppressing the effect of APP on mononuclear phagocytes and acts by competitively inhibiting the access of FPRL1 to APP. Prevents the translocation of BAX from cytosol to mitochondria bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG mt_rnr2-bax-1 15533 hunin_human 15536 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q8IVG9:p.Cys8Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false tagged molecule gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 bax_human 15537 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Fig. 1A homomint mint mt_rnr2-bax-2 15533 N/A 15536 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q8IVG9:p.[Ile16Met;Arg22del;Arg23del;Ala24del] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false tagged molecule gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 N/A 15537 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Fig. 4B, 4C homomint mint mt_rnr2-bax-3 15533 N/A 15536 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 N/A 15537 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Fig. 4B, 4C homomint mint bax-mt_rnr2-3 15534 hunin_human 15536 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 bax_human 15537 protein sequence protein sequence identification protein sequence unspecified role unspecified role unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 15534 Fig. 1C 2 nanomolar homomint mint bax-mt_rnr2-1 15535 hunin_human 15536 full dna sequence full identification by DNA sequencing full dna sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 bax_human 15537 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q07812:p.Ser184Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false homomint mint