MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint birkenfe-2003a-1 Characterization of zetin 1/rBSPRY, a novel binding partner of 14-3-3 proteins. in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Birkenfeld J., Kartmann B., Anliker B., Ono K., Schlötcke B., Betz H., Roth D. Biochem. Biophys. Res. Commun. (0006-291X) 2003 birkenfe-2003a-2 Characterization of zetin 1/rBSPRY, a novel binding partner of 14-3-3 proteins. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Birkenfeld J., Kartmann B., Anliker B., Ono K., Schlötcke B., Betz H., Roth D. Biochem. Biophys. Res. Commun. (0006-291X) 2003 birkenfeld-2003a-1 Characterization of zetin 1/rBSPRY, a novel binding partner of 14-3-3 proteins. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Birkenfeld J., Kartmann B., Anliker B., Ono K., Schlötcke B., Betz H., Roth D. Biochem. Biophys. Res. Commun. (0006-291X) 2003 bspry_rat B box and SPRY domain-containing protein Bspry Zetin-1 protein protein rat Rattus norvegicus (Rat) Rat MSSDVSGTESGSESGPESVPEPVPEPGPEPESEPGPGPAPGPGPGPAPGPGPGLGREPGQRYQPCQLCPEHGKPLSWFCLSERRPVCATCAGFGGRCHRHRIRRAEEHAEELRNKIVDHCEKLQLQSAGITKYVAEVLQGKNQKAMIMANATREVIIQRLSLVRCLCESEEQRLLEQVHSEEERAHQCILTQRAHWDDKLRKLDSLRTSMVDMLTHLNDLQLIQMEQEILERAEEAEGILEPQESEKLSFNEKCAWSPLLTQLWATSVLGSLSGMEDVLIDERTVGPLLNLSEDRKTLTFNAKKSKVCSDDPERFDHWPNALAVNAFQTGLHAWAVNVKHSCAYKVGVASAQLPRKGSGSDCRLGHNAFSWVFSRYDQEFCFSHNGNHEPLALLRCPTQLGLLLDLQAGELIFYEPASGTVLHIHRESFPHRLFPVFAVADQVISIVC mint May regulate epithelial calcium transport by inhibiting TRPV5 activity 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN bspry-ywhaz 12986 bspry_rat 12989 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed Stoichiometry: 1.0 1433z_human 12990 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 colocalization colocalization false false false homomint mint ywhaz-bspry 12987 bspry_rat 12989 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 1433z_human 12990 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint mint ywhaz-bspry-1 12988 bspry_rat 12989 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 1433z_human 12990 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint