MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zhu-2003a-1 The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. Biochem. Biophys. Res. Commun. (0006-291X) 2003 partial coverage rapid curation zhu-2003a-4 The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. unknown Unknown gallex lex-a dimerization assay gallex predetermined predetermined participant predetermined Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. Biochem. Biophys. Res. Commun. (0006-291X) 2003 partial coverage rapid curation zhu-2003a-2 The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. Biochem. Biophys. Res. Commun. (0006-291X) 2003 partial coverage rapid curation zhu-2003a-3 The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. Biochem. Biophys. Res. Commun. (0006-291X) 2003 partial coverage rapid curation ada22_human Disintegrin and metalloproteinase domain-containing protein 22 Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2 Metalloproteinase-disintegrin ADAM22-3 ADAM22 MDC2 protein protein human Homo sapiens Human MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN ada23_human Disintegrin and metalloproteinase domain-containing protein 23 ADAM23 MDC3 Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 protein protein human Homo sapiens Human MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI mint May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein ywhaz-adam22-2 11827 ada22_human ADA22 11831 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433z_human 1433Z 11832 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false The isoform 3 of ADAM 22 was utilized (846aa long).rnIn addition, mutations to alanine of the Ser834 and the Ser857, suggest they can be critical for interaction but no clear phosphorylation dependence is shown. rnrn homomint domino mint adam23-ywhaz 11827 ada23_human ADA23 11833 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 1433z_human 1433Z 11832 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint domino mint adam22-ywhaz-3 11828 ada22_human ADA22_HUMAN 11831 unspecified role unspecified role unspecified role unspecified role 1433z_human 1433Z_HUMAN 11832 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false homomint domino mint adam22-ywhaz-4 11828 ada22_human ADA22_HUMAN 11831 unspecified role unspecified role unspecified role unspecified role 1433z_human 1433Z_HUMAN 11832 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false homomint domino mint ywhaz-adam22-3 11829 ada22_human ADA22 11831 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433z_human 1433Z 11832 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false The isoform 3 of ADAM 22 was utilized (846aa long).rnIn addition, mutations to alanine of the Ser834 and the Ser857, suggest they can be critical for interaction but no clear phosphorylation dependence is shown. rnrn homomint domino mint ywhaz-adam22-4 11830 ada22_human ADA22 11831 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433z_human 1433Z 11832 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false The isoform 3 of ADAM 22 was utilized (846aa long).rnIn addition, mutations to alanine of the Ser834 and the Ser857, suggest they can be critical for interaction but no clear phosphorylation dependence is shown. rnrn homomint domino mint