MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint vanhemer-2003-1 Self-association of the spindle pole body-related intermediate filament protein Fin1p and its phosphorylation-dependent interaction with 14-3-3 proteins in yeast. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined van Hemert MJ., Deelder AM., Molenaar C., Steensma HY., van Heusden GP. J. Biol. Chem. (0021-9258) 2003 vanhemer-2003-2 Self-association of the spindle pole body-related intermediate filament protein Fin1p and its phosphorylation-dependent interaction with 14-3-3 proteins in yeast. in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined van Hemert MJ., Deelder AM., Molenaar C., Steensma HY., van Heusden GP. J. Biol. Chem. (0021-9258) 2003 van_hemert-2003-1 Self-association of the spindle pole body-related intermediate filament protein Fin1p and its phosphorylation-dependent interaction with 14-3-3 proteins in yeast. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined van Hemert MJ., Deelder AM., Molenaar C., Steensma HY., van Heusden GP. J. Biol. Chem. (0021-9258) 2003 fin1_yeast Filament protein FIN1 FIN1 YDR130C YD9302.05C Filaments in between nuclei protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNKSNRRSLRDIGNTIGRNNIPSDKDNVFVRLSMSPLRTTSQKEFLKPPMRISPNKTDGMKHSIQVTPRRIMSPECLKGYVSKETQSLDRPQFKNSNKNVKIQNSDHITNIIFPTSPTKLTFSNENKIGGDGSLTRIRARFKNGLMSPERIQQQQQQHILPSDAKSNTDLCSNTELKDAPFENDLPRAKLKGKNLLVELKKEEEDVGNGIESLTKSNTKLNSMLANEGKIHKASFQKSVKFKLPDNIVTEETVELKEIKDLLLQMLRRQREIESRLSNIELQLTEIPKHK FD4DB73A50F50172 bmh2_yeast Protein BMH2 YD8557.08 YDR099W BMH2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQTREDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELIRSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNSSLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDISESGQEDQQQQQQQQQQQQQQQQQAPAEQTQGEPTK 74788A9103F129FB bmh1_yeast Protein BMH1 YER177W BMH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAEDQQQQQQHQQQQPPAAAEGEAPK 0A234167E313688B fin1-bmh2 13316 fin1_yeast FIN1 13319 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 bmh2_yeast BMH2 13320 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint fin1-bmh1 13316 fin1_yeast FIN1 13319 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 bmh1_yeast BMH1 13321 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false mint bmh1-fin1 13317 fin1_yeast FIN1 13319 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 bmh1_yeast BMH1 13321 unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 association association false false false mint 8.5 micromolar bmh2-fin1 13317 bmh2_yeast BMH2 13320 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 fin1_yeast FIN1 13319 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false mint 0.585 millimolar fin1-bmh2-1 13318 bmh2_yeast BMH2 13320 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 fin1_yeast FIN1 13319 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint