MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lim-2002-1 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lim R., Winteringham LN., Williams JH., McCulloch RK., Ingley E., Tiao JY., Lalonde JP., Tsai S., Tilbrook PA., Sun Y., Wu X., Morris SW., Klinken SP. Table 1 pklinken@cyllene.uwa.edu.au A pVP16 cDNA library made from mRNA prepared from the lymphohemopoietic progenitor cell line EML C.1 was screened. J. Biol. Chem. (0021-9258) 2002 lim-2002-6 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lim R., Winteringham LN., Williams JH., McCulloch RK., Ingley E., Tiao JY., Lalonde JP., Tsai S., Tilbrook PA., Sun Y., Wu X., Morris SW., Klinken SP. Table 1 pklinken@cyllene.uwa.edu.au A pVP16 cDNA library made from mRNA prepared from the lymphohemopoietic progenitor cell line EML C.1 was screened. J. Biol. Chem. (0021-9258) 2002 lim-2002-3 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lim R., Winteringham LN., Williams JH., McCulloch RK., Ingley E., Tiao JY., Lalonde JP., Tsai S., Tilbrook PA., Sun Y., Wu X., Morris SW., Klinken SP. Peptide conjugated to Sepharose beads and exposed to Cos-1 lysate expressing recombinant protein Table 1 pklinken@cyllene.uwa.edu.au A pVP16 cDNA library made from mRNA prepared from the lymphohemopoietic progenitor cell line EML C.1 was screened. J. Biol. Chem. (0021-9258) 2002 lim-2002-4 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lim R., Winteringham LN., Williams JH., McCulloch RK., Ingley E., Tiao JY., Lalonde JP., Tsai S., Tilbrook PA., Sun Y., Wu X., Morris SW., Klinken SP. Cos-7 cells transfected with Mlf1 and/ or NRBP-expressing constructs. Table 1 pklinken@cyllene.uwa.edu.au A pVP16 cDNA library made from mRNA prepared from the lymphohemopoietic progenitor cell line EML C.1 was screened. J. Biol. Chem. (0021-9258) 2002 lim-2002-2 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lim R., Winteringham LN., Williams JH., McCulloch RK., Ingley E., Tiao JY., Lalonde JP., Tsai S., Tilbrook PA., Sun Y., Wu X., Morris SW., Klinken SP. Cos-7 cells transfected with Mlf1-expressing construct. Table 1 pklinken@cyllene.uwa.edu.au A pVP16 cDNA library made from mRNA prepared from the lymphohemopoietic progenitor cell line EML C.1 was screened. J. Biol. Chem. (0021-9258) 2002 lim-2002-5 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Lim R., Winteringham LN., Williams JH., McCulloch RK., Ingley E., Tiao JY., Lalonde JP., Tsai S., Tilbrook PA., Sun Y., Wu X., Morris SW., Klinken SP. Cos-7 cells cotransfected with Mlf1- and NRBP-expressing constructs. Table 1 pklinken@cyllene.uwa.edu.au A pVP16 cDNA library made from mRNA prepared from the lymphohemopoietic progenitor cell line EML C.1 was screened. J. Biol. Chem. (0021-9258) 2002 1433z_mouse 14-3-3 protein zeta/delta Ywhaz Protein kinase C inhibitor protein 1 SEZ-2 protein protein mouse Mus musculus Mouse MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN mlf1_mouse Myeloid leukemia factor 1 Mlf1 Hls7 Myelodysplasia-myeloid leukemia factor 1 Hematopoietic lineage switch 7 protein protein mouse Mus musculus Mouse MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSISDGRGRTHNRRERDDGEDSLTHADVNPFQTMDRMMANMRSGIQELQRNFGQLSMDPNGHSFCSSSVMTYSKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQNEVLKYKSIGRSGNTGMRSVGHEHPGSRELKRREKIHRNSAIESGRRSNVFVDKLNVKGSPVKITKK dyl2_mouse Dynein light chain 2, cytoplasmic Dynein light chain LC8-type 2 8 kDa dynein light chain b Dynll2 Dlc2 protein protein mouse Mus musculus Mouse MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG eif3g_mouse Eukaryotic translation initiation factor 3 subunit G Eif3s4 Eukaryotic translation initiation factor 3 subunit 4 eIF-3-delta Eukaryotic translation initiation factor 3 RNA-binding subunit eIF3 p44 eIF3 p42 Eif3g Eif3p42 protein protein mouse Mus musculus Mouse MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLPTGDTSPEPELLPGDPLPPPKEVINGNIKTVTEYKIEEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQAAQSKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN cybp_mouse Calcyclin-binding protein Siah-interacting protein Cacybp Sip protein protein mouse Mus musculus Mouse MASVLEELQKDLEEVKVLLEKSTRKRLRDTLTSEKSKIETELKNKMQQKSQKKPELDNEKPAAVVAPLTTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKNYSMIVNNLLKPISVESSSKKVKTDTVIILCRKKAENTRWDYLTQVEKECKEKEKPSYDTEADPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAREDTEF nucl_mouse Nucleolin Protein C23 Ncl Nuc protein protein mouse Mus musculus Mouse MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVIPTPGKKGAAQAKALVPTPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDDEEEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTAKGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKRKKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDFKPQGKKTKFE nrbp_mouse Nuclear receptor-binding protein MLF1 adapter molecule HLS7-interacting protein kinase Nrbp1 Madm Nrbp protein protein mouse Mus musculus Mouse MSEGESQTVVSSGSDPKVESSSLAPGLTSVSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKIGSVAPDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGESSYVPQEAISSAIQLLEDSLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMIPENALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNESIPDLAAELVQLGFISEADQSRLTSLLEETLNKFNFTRNSTLNTATVTVSS mlf1_human Myeloid leukemia factor 1 Myelodysplasia-myeloid leukemia factor 1 MLF1 protein protein human Homo sapiens Human MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK 1433z_cerae_protein 14-3-3 protein zeta/delta protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt mlf1-ywhaz-1 Interaction of Mlf1 with 14-3-3 zeta identified by Y2H. 11313 N/A 11319 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 11320 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mlf1-dlc2-1 Interaction of Mlf1 with DLC2 identified by Y2H. 11313 N/A 11320 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 11321 unspecified role unspecified role prey prey physical association physical association false false false mlf1-eif3s4-1 Interaction of Mlf1 with EIF3S4 identified by Y2H. 11313 N/A 11322 unspecified role unspecified role prey prey N/A 11320 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mlf1-cacybp-1 Interaction of Mlf1 with CACYBP identified by Y2H. 11313 N/A 11320 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 11323 unspecified role unspecified role prey prey physical association physical association false false false mlf1-ncl-1 Interaction of Mlf1 with NCL identified by Y2H. 11313 N/A 11324 unspecified role unspecified role prey prey N/A 11320 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mlf1-nrbp-1 Interaction of Mlf1 with Nrbp identified by Y2H. 11313 N/A 11320 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 11325 unspecified role unspecified role prey prey physical association physical association false false false NRBP is the protein identified as M44 in Table 1 mlf1-nrbp-4 Interaction of Mlf1 with Nrbp identified by Y2H. 11314 N/A 11325 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 11320 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mlf1-nrbp-5 Interaction of Mlf1 with Nrbp identified by Y2H. 11314 N/A 11320 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 11325 unspecified role unspecified role bait bait physical association physical association false false false mlf1-nrbp-6 Interaction of NPM-MLF1 with Nrbp (Madm) identified by Y2H. 11314 n/a 11326 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 11325 unspecified role unspecified role bait bait physical association physical association false false false nrbp-nrbp-2 Homodimerizationaction of Nrbp (Madm) identified by Y2H. 11314 N/A 11325 unspecified role unspecified role bait bait N/A 11325 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mlf1-ywhaz-3 Interaction of Mlf1 with 14-3-3 zeta identified by pulldown 11315 N/A 11319 unspecified role unspecified role prey prey N/A 11320 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ser34 (required) opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false mlf1-ywhaz-4 Interaction of Mlf1 with 14-3-3 zeta identified by pulldown 11315 N/A 11320 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ser34 (required) opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 11327 unspecified role unspecified role prey prey physical association physical association false false false mlf1-nrbp-2 Interaction of Mlf1 with NRBP identified by coimmunoprecipitation 11316 N/A 11325 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 11320 unspecified role unspecified role prey prey physical association physical association false false false nrbp-nrbp-1 Homodimerization of Nrbp (Madm) identified by coimmunoprecipitation 11316 N/A 11325 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 11325 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mlf1-ywhaz-2 Interaction of Mlf1 with 14-3-3 zeta identified by coimmunoprecipitation 11317 N/A 11327 unspecified role unspecified role bait bait N/A 11320 unspecified role unspecified role prey prey physical association physical association false false false Interaction inhibited by phosphorylated MLF-1 peptide MRQMIRSFSEPFGRDL mlf1-nrbp-3 Interaction of Mlf1 with NRBP identified by coimmunoprecipitation 11318 N/A 11325 unspecified role unspecified role neutral component neutral component N/A 11320 unspecified role unspecified role neutral component neutral component physical association physical association false false false