UniProt UniProt http://www.uniprot.org hruska_hage-2002-1 Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel). yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hruska-Hageman AM., Wemmie JA., Price MP., Welsh MJ. Biochem. J. (0264-6021) 2002 hruska_hage-2002-2 Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel). yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hruska-Hageman AM., Wemmie JA., Price MP., Welsh MJ. Biochem. J. (0264-6021) 2002 hruska_hage-2002-3 Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel). chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Hruska-Hageman AM., Wemmie JA., Price MP., Welsh MJ. Biochem. J. (0264-6021) 2002 hruska_hage-2002-4 Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel). chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Hruska-Hageman AM., Wemmie JA., Price MP., Welsh MJ. Biochem. J. (0264-6021) 2002 hruska_hage-2002-5 Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel). rat-hippocampus Rattus norvegicus hippocampal neurons hippocampus Hippocampus [Brain hippocampus] imaging technique imaging technique microscopy immunostaining immunostaining Hruska-Hageman AM., Wemmie JA., Price MP., Welsh MJ. Biochem. J. (0264-6021) 2002 pick1_human PRKCA-binding protein PICK1 PRKCABP Protein kinase C-alpha-binding protein Protein interacting with C kinase 1 protein protein human Homo sapiens Human MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS asic2_human Acid-sensing ion channel 2 ASIC2 ACCN ACCN1 Amiloride-sensitive brain sodium channel Amiloride-sensitive cation channel 1, neuronal Amiloride-sensitive cation channel neuronal 1 BNAC1 Brain sodium channel 1 MDEG Mammalian degenerin homolog protein protein human Homo sapiens Human MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVESSERVSYYFSYQHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQKKAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIAC asic1_human Acid-sensing ion channel 1 ASIC1 ACCN2 Amiloride-sensitive cation channel 2, neuronal BNAC2 Brain sodium channel 2 protein protein human Homo sapiens Human MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC acnn1-prkcabp-1 16207 N/A 16212 unspecified role unspecified role prey prey N/A 16213 unspecified role unspecified role bait bait physical association physical association false false false aa 470-512 of ACCN1 sufficient accn1-prkcabp-1 16207 N/A 16212 unspecified role unspecified role prey prey N/A 16213 unspecified role unspecified role bait bait physical association physical association false false false accn2-prkcabp-1 16208 N/A 16212 unspecified role unspecified role prey prey N/A 16214 unspecified role unspecified role bait bait physical association physical association false false false aa 505 - 574 of ACCN2 sufficient accn1-prkcabp-2 16209 N/A 16213 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 16212 unspecified role unspecified role bait bait chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association false false false aa 509- 512 of ACCN1 are necessary accn2-prkpcabp-2 16210 N/A 16214 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 16212 unspecified role unspecified role bait bait chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association false false false aa 571 - 574 of ACCN2 are necessary accn2-prkcabp-3 16211 N/A 16214 unspecified role unspecified role neutral component neutral component N/A 16212 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false