UniProt UniProt http://www.uniprot.org provost-2001-1 5-Lipoxygenase interacts with coactosin-like protein. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Provost P., Doucet J., Hammarberg T., Gerisch G., Samuelsson B., Radmark O. J. Biol. Chem. (0021-9258) 2001 provost-2001-2 5-Lipoxygenase interacts with coactosin-like protein. human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Provost P., Doucet J., Hammarberg T., Gerisch G., Samuelsson B., Radmark O. J. Biol. Chem. (0021-9258) 2001 provost-2001-3 5-Lipoxygenase interacts with coactosin-like protein. human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Provost P., Doucet J., Hammarberg T., Gerisch G., Samuelsson B., Radmark O. J. Biol. Chem. (0021-9258) 2001 provost-2001-4 5-Lipoxygenase interacts with coactosin-like protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Provost P., Doucet J., Hammarberg T., Gerisch G., Samuelsson B., Radmark O. J. Biol. Chem. (0021-9258) 2001 cotl1_human Coactosin-like protein COTL1 CLP protein protein human Homo sapiens Human MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE lox5_human Polyunsaturated fatty acid 5-lipoxygenase ALOX5 LOG5 Arachidonate 5-lipoxygenase protein protein human Homo sapiens Human MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI cotl1-alox5-1 16479 N/A 16483 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 16484 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false COTL1 was expressed as GST-fusion in E. coli. ALOX5 was purified from transformed E. coli strain MV1190. cotl1-alox5-2 16480 N/A 16483 unspecified role unspecified role bait bait human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 16484 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false cotl1-alox5-3 16481 N/A 16483 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 16484 unspecified role unspecified role bait bait human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false cotl1-alox5-4 16482 N/A 16483 unspecified role unspecified role bait bait N/A 16484 unspecified role unspecified role prey prey physical association physical association false false false