UniProt UniProt http://www.uniprot.org lin-2001-1 Mitogen-stimulated TIS21 protein interacts with a protein-kinase-Calpha-binding protein rPICK1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin WJ., Chang YF., Wang WL., Huang CY. wjlin@ym.edu.tw Biochem. J. (0264-6021) 2001 lin-2001-2 Mitogen-stimulated TIS21 protein interacts with a protein-kinase-Calpha-binding protein rPICK1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lin WJ., Chang YF., Wang WL., Huang CY. wjlin@ym.edu.tw Biochem. J. (0264-6021) 2001 lin-2001-3 Mitogen-stimulated TIS21 protein interacts with a protein-kinase-Calpha-binding protein rPICK1. mouse Mus musculus Mouse coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Lin WJ., Chang YF., Wang WL., Huang CY. wjlin@ym.edu.tw Biochem. J. (0264-6021) 2001 btg2_rat Protein BTG2 Btg2 Pc3 BTG family member 2 NGF-inducible anti-proliferative protein PC3 protein protein rat Rattus norvegicus (Rat) Rat MSHGKRTDMLPEIAAAVGFLTSLLRTRGCVSEQRLKVFSRALQDALTDHYKHHWFPEKPSKGSGYRCIRINHKMDPIISKVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPVATSYGLLTCKNQMMLGRSSPSKNYVMTVSS pick1_rat PRKCA-binding protein Pick1 Prkcabp Protein kinase C-alpha-binding protein Protein interacting with C kinase 1 protein protein rat Rattus norvegicus (Rat) Rat MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGPNQGGFTDGEDEEEEEEDGAAREVSKDARGATGPTDKGGSWCDS btg2-prkcabp-1 16239 N/A 16242 unspecified role unspecified role prey prey N/A 16243 unspecified role unspecified role bait bait physical association physical association false false false aa 49 - 122 of BTG2 sufficient btg2-prkcabp-2 16240 N/A 16243 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 16242 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false btg2-prkcabp-3 16241 N/A 16242 unspecified role unspecified role prey prey mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells N/A 16243 unspecified role unspecified role bait bait mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells physical association physical association false false false