IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ newsome-2000-1 Trio combines with dock to regulate Pak activity during photoreceptor axon pathfinding in Drosophila. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Newsome TP., Schmidt S., Dietzl G., Keleman K., Asling B., Debant A., Dickson BJ. Cell (0092-8674) 2000 newsome-2000-2 Trio combines with dock to regulate Pak activity during photoreceptor axon pathfinding in Drosophila. in vitro In vitro 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid western blot western blot Immuno blot Immuno blot Newsome TP., Schmidt S., Dietzl G., Keleman K., Asling B., Debant A., Dickson BJ. Cell (0092-8674) 2000 rac1_drome Ras-related protein Rac1 Rac1 RacA CG2248 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL rac2_drome Ras-related protein Rac2 Rac2 RacB CG8556 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCALL pak_drome Serine/threonine-protein kinase Pak Pak DPAK Dpak1 CG10295 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSEEDKPPAPPVRLTSNRGGNERSGGGVGVGGGGLGGGGMGDVPPDMRPLPKEPDDSDRKKKTLKSKIKGSKPSHTDSKPNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVLKWFDNTTKQRPSSKYMTNAITTHSGSSLSRVSSSSPSSTPTDSELHGSNSGGNLIGVQLGSMTLGPNANNVAVAGQILGNHYQQQQQHLLQQQQPLLHQNHNQHHMGISQSHSYNFVGHTVSSSTSQHSSANEDDMLGPQHPQQQPPPPPVASRPERTKSIYTRPIEDLQPAIIPMPVAPATTPATPLQNHRTPGGISAPAASPMMHNNATTTLDKNKNNANLYTPEPTVAQVSAGGPSSQVAGNQIAVPQAAVAPAATPNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAAKEATKGN pak-rac1-2 GST Pull down of Pak by Rac 1. 15179 N/A 15181 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15182 unspecified role unspecified role prey prey physical association physical association false false false pak-rac-2 Interaction of Pak with Rac detected by GST pull down assay. 15179 N/A 15182 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15183 unspecified role unspecified role prey prey physical association physical association false false false Pak was Myc tagged while Rac 2 was GST tagged in the experiment. pak-rac1-3 Interaction detected by Y2H. 15180 N/A 15183 unspecified role unspecified role bait bait N/A 15181 unspecified role unspecified role prey prey physical association physical association false false false Interaction observed only in the presence of GTP-bound form of Rac1.