MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint azevedo-2002-1 The RAR1 interactor SGT1, an essential component of R gene-triggered disease resistance. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Azevedo C., Sadanandom A., Kitagawa K., Freialdenhoven A., Shirasu K., Schulze-Lefert P. Science (0036-8075) 2002 q9se34_horvu Rar1 protein protein horvu Hordeum vulgare (Barley) Barley MSAETERSAAAPAPAPMRCQRIGCDAMFTDDDNPDGSCHYHPSGPLFHDGMKEWSCCKQRSHDFSLFLAIPGCATGKHTTEKPVTKAVSLNSSKATPPKSAPVQSSKQGVETEACSRCRQGFFCSDHGSQPKAQKPVAVNGTNTESVQKSSVPEPKKKVVDINEPRVCKNKGCGKTYKEKDNHDAACDYHPGPAVFHDRNRGWKCCDVHVKEFDEFMEIPPCTKGWHNADAV mint sgt1b_arath Protein SGT1 homolog B SGT1B EDM1 ETA3 At4g11260 RPR1 Protein ENHANCED DOWNY MILDEW 1 Protein ENHANCER OF TIR1-1 AUXIN RESISTANCE 3 Suppressor of G2 allele of SKP1 homolog B F8L21.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKELAEKAKEAFLDDDFDVAVDLYSKAIDLDPNCAAFFADRAQANIKIDNFTEAVVDANKAIELEPTLAKAYLRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEEEKDLVQPMPPSLPSSSTTPLATEADAPPVPIPAAPAKPMFRHEFYQKPEEAVVTIFAKKVPKENVTVEFGEQILSVVIDVAGEEAYHLQPRLFGKIIPEKCRFEVLSTKVEIRLAKAEIITWASLEYGKGQSVLPKPNVSSALSQRPVYPSSKPAKDWDKLEAEVKKQEKDEKLDGDAAMNKFFSDIYSSADEDMRRAMNKSFAESNGTVLSTNWKEVGTKKVESTPPDGMELKKWEY rar1_arath Cysteine and histidine-rich domain-containing protein RAR1 RAR1 At5g51700 PBS2 RPR2 AtRAR1 CHORD domain-containing protein RAR1 Protein PPHB SUSCEPTIBLE 2 Protein REQUIRED FOR MLA12 RESISTANCE 1 MIO24.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVGSATKKLQCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEKPVLAKSVPKHPVAAPTSSPDANAATKDSCSRCRQGFFCSDHGSQPKEQIKQTLNTPGQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFMEIPPCTKGWHSSSPDPAV sgt1a_arath Protein SGT1 homolog A SGT1A F9D16.40 At4g23570 Suppressor of G2 allele of SKP1 homolog A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKELADKAKEAFVDDDFDVAVDLYSKAIDLDPNCAEFFADRAQAYIKLESFTEAVADANKAIELDPSLTKAYLRKGTACMKLEEYRTAKTALEKGASITPSESKFKKLIDECNFLITEEEKDLVQPVPSTLPSSVTAPPVSELDVTPTAKYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEHGKGPAVLPKPNVSSEVSQRPAYPSSKKVKDWDKLEAEVKKQEKDEKLEGDAALNKFFREIYQNADEDMRRAMSKSFVESNGTVLSTNWQEVGTKTIESTPPDGMELKKWEI sgt1b-rar1 8938 q9se34_horvu Q9SE34 8939 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q9sut5_arath Q9SUT5 8940 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint rar1-sgt1b 8938 q9sut5_arath Q9SUT5 8940 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q9se33_arath Q9SE33 8941 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint rar1-sgt1a 8938 q9se33_arath Q9SE33 8941 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q8w515_arath Q8W515 8942 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint rar1-sgt1a-1 8938 q9se34_horvu Q9SE34 8939 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q8w515_arath Q8W515 8942 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint