MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint strathmann-2001-1 BZI-1 specifically heterodimerises with the tobacco bZIP transcription factors BZI-2, BZI-3/TBZF and BZI-4, and is functionally involved in flower development. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Strathmann A., Kuhlmann M., Heinekamp T., Dröge-Laser W. Plant J. (0960-7412) 2001 q93ym7_tobac BZI-1 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MERVFSMEDDIGDHFWSTPPTADLGVDSPTAAAAVSYSKMMNRSSSEWAFQRFLQEATAAGTSTSSPPQPPTMTASSSSSSHQNDVVEIKDENLSIPNLNPSTALNSKPASSFGLAPPPNIAVDSEEYQAFLKSQLHLACAAVALTRGKSLNPQDSGSTAHDKGSETASAAQSGSHVSTLGSGQEVAKIQDKDAGGPVGIPSLPPVQKKPVVQVRSTTSGSSREQSDDDEAEGEAETTQGMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRTKVKMAEETVKRVTGLNPLFQAMSEISSMVMPSYSGSPSDTSADAAVPVQDDPKHHYYQQPPNNLMPTHDPRIQNGMVDVPPIENVEQNPATAAVGGNKMGRTTSMQRVASLEHLQKRIRGEVSSCGTQGRGEQ mint q941l5_tobac LOC107808808 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MSALRQSASSSASEDDQRYAGMDEKKRKRMISNRESARRSRMKKQKLLQDLTGEVSRLQVANKNILAKIEETTERYTVCTAQNNVLKAHAMELNDRLRYLNDVINDTGLAVDAADPLLKPLQIPRPMQPIASSGLFKF mint q941l6_tobac protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MALTQQPASSGSDGQRYATNDDRKRKRMESNRESARRSRMRKQQHLEELMSQMTQLQNQNVLWREKIDAVGRNYLTLDAENNVLRAQMAELTERLDSLNSLTRFWADANGLAVDIPEIPDTLLEPWQLPCPIQPITASADMFKF mint q941l7_tobac LOC107766289 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MASSSGTSSGSSLFLQNSGSEEDLQQLVDQRKRKRMISNRESARRSRMRKQKHLDDLMAQVATLRKENNQILTSMNVTTQHYLNVEAENSILRAQLAELNHRLESLNEIIAFLDANNNCNGLANMDHNQEEPYSFNFAQNEPMVDGFNMTNSWNYLCANQPIMTADVLQY mint bzi_1-q941l5 11186 q93ym7_tobac 11187 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q941l5_tobac 11188 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint bzi_1-q941l6 11186 q93ym7_tobac 11187 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 q941l6_tobac 11189 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint bzi_1-q941l7 11186 q93ym7_tobac 11187 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q941l7_tobac 11190 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint