MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint wilhelmj-2000-1 Isolation of a ribonucleoprotein complex involved in mRNA localization in Drosophila oocytes. in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Wilhelm JE., Mansfield J., Hom-Booher N., Wang S., Turck CW., Hazelrigg T., Vale RD. J. Cell Biol. (0021-9525) 2000 wilhelm-2000-1 Isolation of a ribonucleoprotein complex involved in mRNA localization in Drosophila oocytes. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Wilhelm JE., Mansfield J., Hom-Booher N., Wang S., Turck CW., Hazelrigg T., Vale RD. J. Cell Biol. (0021-9525) 2000 exu_drome Maternal protein exuperantia exu CG8994 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVADNIDAGVAIAVADQSSSPVGDKVELPAGNYILVGVDIDTTGRRLMDEIVQLAAYTPTDHFEQYIMPYMNLNPAARQRHQVRVISIGFYRMLKSMQTYKIIKSKSEIAALKDFLNWLEQLKTKAGPSSDGIVLIYHEERKFIPYMILESLKKYGLLERFTASVKSFANSINLAKASIGDANIKNYSLRKLSKILSTTKEEDAACSASTSGSGSGLGSGSSMVSDSVSISPRDSTVTNGDDKQSSKNAVQGKRELFDGNASVRAKLAFDVALQLSNSDGKPEPKSSEALENMFNAIRPFAKLVVSDVLELDIQIENLERQNSFRPVFLNYFKTTLYHRVRAVKFRIVLAENGFDLNTLSAIWAEKNIEGLDIALQSIGRLKSKDKAELLELLDSYFDPKKTTVKPVVKGNSNNNNNYRRRNRRGGRQSVKDARPSSSPSASTEFGAGGDKSRSVSSLPDSTTKTPSPNKPRMHRKRNSRQSLGATPNGLKVAAEISSSGVSELNNSAPPAVTISPVVAQPSPTPVAITASN q95re4_drome yps Dmel\CG5654 YPS Yps p45 p57 Dmel_CG5654 CG5654 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQQQVQSGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPGGPRRYNNYYLRQPRRGLGGGDGSAEPGVHDQNPEGLQRGEGQGPRRGGGPPGGPQRRFFRRNFNNGPPPPRRDGGEYIQGQGPPRPQQPRPRRQRKPNGPGGGSEQQPEKNGAQELQNTTTESTA exu-yps 6899 exu_drome 6901 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 q95re4_drome 6902 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region mutation analysis mutation analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false The Exu-Yps complex contains oskar mRNA. mint exu-yps-2 6899 exu_drome 6901 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 q95re4_drome 6902 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region mutation analysis mutation analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false Stoichiometry: 1.0 colocalization colocalization false false false The Exu-Yps complex contains oskar mRNA. mint exu-yps-1 6900 q95re4_drome 6902 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region mutation analysis mutation analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false Stoichiometry: 1.0 exu_drome 6901 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false The Exu-Yps complex contains oskar mRNA. mint