MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint o_connor-1998-1 Bim: a novel member of the Bcl-2 family that promotes apoptosis. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined O'Connor L., Strasser A., O'Reilly LA., Hausmann G., Adams JM., Cory S., Huang DC. EMBO J. (0261-4189) 1998 b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK b2l11_mouse Bcl-2-like protein 11 Bcl2-interacting mediator of cell death Bcl2l11 Bim protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK bcl2l11-bcl2l1-6 6498 b2cl1_human 6499 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 b2l11_mouse 6500 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false homomint mint bcl2l11-bcl2l2 6498 b2l11_mouse 6500 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 b2cl2_human 6501 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint mint